SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008330 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008330
Domain Number 1 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 68-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000008330
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00961
Family SCAN domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008330   Gene: ENSCHOG00000009413   Transcript: ENSCHOT00000009434
Sequence length 524
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_7297:7210:18257:1 gene:ENSCHOG00000009413 transcript:ENSCHOT00000009434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASPWVKFHHMKKAKEEVPLWDDVIKIFEGEALLSQDADMIQRESLENE
VTPGLPTAEPQELLTFKDVSVDFTQEEWGRLAPAHQNLYQEVMLENYRNLVSVGYQLPKP
NVISQLEKGKEPWMTEKEGPGDPSSDLKTKTETNESAAMNDISQEQLYHGIVMERFMRDD
VIYSTLRKVSKYNDELESPQETCRRDVRQAILTLKKRGQETNKFRENIFVSSNVIIEQRN
HKCDTPRRRNKYNLDLINHSTSYVRMKTFECNVCLKVFKQPIHLTEHMRIHTGEKPFRCK
ECGRAFSQSASLTTHQRIHTGEKPFVCEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQK
AFSQNISLIQHLRTHSGEKPFTCNECGKTFRQVRHLSEHIRIHTGEKPYACTACCKTFSH
RAYLTHHQRIHTGEKPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSF
KKHQRRHTGERPYECNECGKAFSYNSSLSRHCEIHRRKLFQNNV
Download sequence
Identical sequences ENSCHOP00000008330 ENSCHOP00000008330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]