SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008906 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008906
Domain Number 1 Region: 441-514
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.33e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 144-208
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000523
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 230-284,311-324
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000349
Family BphP N-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008906   Gene: ENSCHOG00000010045   Transcript: ENSCHOT00000010081
Sequence length 840
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_4200:3306:37114:-1 gene:ENSCHOG00000010045 transcript:ENSCHOT00000010081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSAVTVAAVRRRVWGVALSSPSPQARWRRLLPGWGWRGGGVIYDHGGDCCPXXXXXXXX
XXXXXXXXXXXXMASDVPSLGATIASGNPGPGIQGGGTIIQRAIKRRPGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVP
TCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQLEAADGFLFIVSCET
GRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGT
VKKEGQQSSMRMCMGSRRSFICRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFR
FRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTSVKNSSQEPRPTLSNTIQRPQLGSIA
NVPLEMGSGQLVPRQQQQQTELDVVPGREGLTSYNHSQVSVQPVTTTGPEHSKPLEKSDG
LFAQDRDPRFSEIYSNINADQSKGISSSTVTATQQLFSQGNTFPPNPRSAENFXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVASQATAKTRSPQFGV
GNFQTPSSFSPMPLPGAPTASSGAAAYPSLTNRGPNFVPETGQSAGQFQTRTAEGVSVWP
QWQGQQPHHRSSSSEQHVQQPSGPQPGQPEVFQEMLMLGDQNNSYNNEEFDLTMFPHFSE
Download sequence
Identical sequences ENSCHOP00000008906 ENSCHOP00000008906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]