SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011570 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011570
Domain Number 1 Region: 378-591
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-57
Family Nuclear receptor ligand-binding domain 0.0000938
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000011570
Domain Number - Region: 112-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000581
Family Nuclear receptor 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011570   Gene: ENSCHOG00000013048   Transcript: ENSCHOT00000013096
Sequence length 604
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2670:5657:43563:-1 gene:ENSCHOG00000013048 transcript:ENSCHOT00000013096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILTNHDGSAPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSG
MFVNIHQCGVKNESTVMTPDKAESCQGDLSTLASVVTSLANLGKTKDLSQNSNEMSMIGN
LSNGDTSLCEFHQEIQTNGDVSRAFDTLAKALNPGESTTCQNSVEGMEASVHLIAGDSSI
NYIEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQ
ENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKVSAERRKLLMEHI
FKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITKT
YPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQII
GHSI
Download sequence
Identical sequences ENSCHOP00000011570 ENSCHOP00000011570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]