SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011633 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011633
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-33
Family Nuclear receptor ligand-binding domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011633   Gene: ENSCHOG00000013134   Transcript: ENSCHOT00000013170
Sequence length 192
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_3229:2346:4350:-1 gene:ENSCHOG00000013134 transcript:ENSCHOT00000013170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTVAFLRNPSFYQLPLQDQQRLLRGSWGPLFLLGLAQDAVTFQVAEAPVPSILKKILLEE
PGSRSGSAQLPDRPQPSLAAVQWLQYCLESFWSLELGPKEYAYLKGTVLFNPXXXXXXXX
XXXXXXQQEAHQALCEVLEPQCPAGQVRLARVLLMASILKSIPPSLLGDLFFRPVIGDAD
ITSLLEDMLLLR
Download sequence
Identical sequences ENSCHOP00000011633 ENSCHOP00000011633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]