SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000012394 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000012394
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-36
Family SCAN domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 798-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-22
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 5 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 910-966
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 629-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 854-910
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 686-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 365-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 13 Region: 951-1000
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000216
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 14 Region: 213-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000288
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000012394   Gene: ENSCHOG00000013986   Transcript: ENSCHOT00000014027
Sequence length 1028
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_7425:38903:50110:1 gene:ENSCHOG00000013986 transcript:ENSCHOT00000014027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRENWAHNALRQEGLIKGKGDIWKWGTTFQWSSSSVWETSHLHFRQLRYHETSGPQEAL
TRLRELCRRWLRPEARTKAQILDLLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEEL
QKDLDGPTLKIPVLAKNHDTLQEGLSSPGTAHTSASGVSHMSTETRPNPLTDPVVFSLQD
LQHDPPAPEASALSQEENPRNQLMALMLLTAHPELVMFDEVSVCCTSEEWACLCPIQRAL
YWDVXXXXXXXXXXXXWETMTENEEVTSKPGISQRASSHKGTSKRFQGGVPQVLDFEEEC
EWQVLTRQWGNETGEMVDTVKKGSFRERDKKKRTAPEKRGQKFKELGESLTLGSVLSESL
ISTEGKKLYKCDLCCKHFSKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHS
GEKPYKCSECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERP
YKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCD
ECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTYVCKKCGK
IFSSKSNLIDHKRMHIREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFIL
KKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECLECGKTFIMSKSF
MVHQKLHTQEKVYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEHK
RIHSGEKPYECDECGRCFILKKSLIGHQRIHTREKSYKCNDCEKVFSYRSNLIAHQRIHT
GEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGERP
YKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCN
DCSKVFRQRKNLTVHQKIHTDEKPDECDGSEKEFSQTSNIHLQQKFHTVEEFSWLQNNSE
SKIEIQKI
Download sequence
Identical sequences ENSCHOP00000012394 ENSCHOP00000012394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]