SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|513845203|ref|YP_008125072.1| from Lactobacillus plantarum 16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|513845203|ref|YP_008125072.1|
Domain Number 1 Region: 267-441,560-655,725-813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000228
Family ABC transporter ATPase domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 26-146
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000192
Family PHP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|513845203|ref|YP_008125072.1|
Sequence length 861
Comment hypothetical protein Lp16_D013 [Lactobacillus plantarum 16]
Sequence
MTKYAKFYKCALQVNPCSYAKYRGETISDENSYNRELVRECETNEIKVIGLADHENAASS
EKLRTALKNQGILVFPGFEITSSEHIHIICLFSNDISTEELKSNLIFLMGDPNLKLNTTP
SKKSFGTIMEEVNGKLHGFAFAAHITSDNGILKRGQTSLAWQSESFRVAQIPAAIDEIEP
KYKGIIKNTDPAYKRKTPIIFINAKDIEKPADLRNESASFRVKMSELSFSSFKMALSDPQ
SRIILNSEYAKVYPTYIDSIKVIGGYLDGLSIDLSKSLNTIIGGRGTGKSTLISLIRYAL
DDEPSDKDNRKDLKEIISSNMGVSGVVTLGIKSNEQFDESFTIKRRFGQEPIVLNKDGNV
QSLKVKDIIPNIEIYGQNEIMSTVGDLEKKRKVVARLITVDKKITSKIEDSSRKISDNAK
QIKELLAKKDDYDEKLTELPKIENQYNTLTNQGVIEKLKTFAPFIRQQATFNSLKNNIYN
YQFTLPNLIGTDELSSSHVKALNHEITEFNSFLKEETNRINGKLNEIQLVYKSELQKWTN
EKKVADSSIKNVIQSLPDFHDRNPNELATVYQDVMTQRESLRPLKDKSATVSKELNELKQ
TRLNLIEAYKSALDEKNNSVNKQIKSLNKHQLNGKLRLEIQPQGNIQKLLDYLEKLPGIG
VAKLKGIADQSTVDVFTFTKNIRTESLETLMNTYHLTKMTADTLKKLNETQLLEIEDIRL
PDIANIQLLVGEKFKDIASLSKGQQCTAILDIIMLDNKDPLIVDQPEDNLDNSFITKNLV
DGVRHNKNSRQYIFATHNANIPVFGDAELIVTLHEDDGQGKADDDGIGSIDDENVKNNVI
NILEGGAKAFKMRENKYNIER
Download sequence
Identical sequences A0A2K3C1K4 R9X812
gi|513845203|ref|YP_008125072.1| WP_016526722.1.66154 gi|513845203|ref|YP_008125072.1|NC_021526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]