SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397654823|ref|YP_006495506.1| from Corynebacterium ulcerans 0102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397654823|ref|YP_006495506.1|
Domain Number 1 Region: 52-460
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.49e-130
Family Di-heme elbow motif 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397654823|ref|YP_006495506.1|
Sequence length 483
Comment hypothetical protein CULC0102_2073 [Corynebacterium ulcerans 0102]
Sequence
MSTHASKTRRRYLILTGAIIVTALITMSITALLINIMERKSEVTDHFANVVNIDENVVDP
AEWGKNFPLQYESYLKTSEMGATTHGGSVKESRQPDDKDPRTEVAKSRIEEDPRLKEMWS
GYAFAVDYREARGHQYMLDDQRKTKRVTEFKQPGTCLNCHASTVKLMNDLGDGDANEGFK
KMNKMSYKEVTQLVEHPVACIDCHDPKTMQLRITRPAFANGIRDLKASQGVKDFDVNRDA
THEEMRSYVCGQCHVEYYFKGEDKTLTFPWAKGIEIDQIWDYYKEDGHVDFVNTKTGADI
VKAQHPEFDVWSNSIHAQNGVSCSDCHMPYERHGAKKVSSHHLQSPLLNINNSCMTCHNS
SDKEMEQRVVQIQDRFIHSRDQAFDSLTALIKDLEKAKDDPATPEDRLKLAREYQNKASF
YLDYVYSENSNGFHAPDYIQRIISDSLDASRKGQLVLQGVDLKTLEPSSVTQKNKEAAQS
RGH
Download sequence
Identical sequences V6V2X1
gi|384516456|ref|YP_005711548.1| gi|397654823|ref|YP_006495506.1| WP_014526290.1.12475 WP_014526290.1.16856 WP_014526290.1.41020 WP_014526290.1.44035 WP_014526290.1.44734 WP_014526290.1.45382 WP_014526290.1.72198 WP_014526290.1.74377 WP_014526290.1.83743 WP_014526290.1.91675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]