SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397654824|ref|YP_006495507.1| from Corynebacterium ulcerans 0102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397654824|ref|YP_006495507.1|
Domain Number 1 Region: 16-159
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.2e-22
Family Di-heme elbow motif 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397654824|ref|YP_006495507.1|
Sequence length 161
Comment hypothetical protein CULC0102_2074 [Corynebacterium ulcerans 0102]
Sequence
MGSGMRKHRVLTSALVVQILAIFVIGSFVGVGLYTFIYAKGYSYLGNDPKACVNCHVMEP
QYNAWLAGSHSAVATCNDCHVPHDNIVHKYLVKAEHGVNHGFKFTTGWFPDNIQIRDASR
KVTNDACLTCHGDFTSDIHGTYGETQIQCTHCHATVGHKTR
Download sequence
Identical sequences A0A0E3N8L5 V6V190
gi|397654824|ref|YP_006495507.1| WP_014836829.1.12475 WP_014836829.1.16856 WP_014836829.1.41020 WP_014836829.1.44035 WP_014836829.1.44734 WP_014836829.1.45382 WP_014836829.1.53475 WP_014836829.1.72198 WP_014836829.1.74377 WP_014836829.1.83743 WP_014836829.1.91675 WP_014836829.1.96929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]