SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397654245|ref|YP_006494928.1| from Corynebacterium ulcerans 0102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397654245|ref|YP_006494928.1|
Domain Number 1 Region: 37-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-47
Family Ribonuclease PH domain 1-like 0.00000073
Further Details:      
 
Domain Number 2 Region: 361-559
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-43
Family Ribonuclease PH domain 1-like 0.00000104
Further Details:      
 
Domain Number 3 Region: 518-616
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.62e-23
Family Ribonuclease PH domain 2-like 0.0000247
Further Details:      
 
Domain Number 4 Region: 179-299
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.25e-22
Family Ribonuclease PH domain 2-like 0.0000121
Further Details:      
 
Domain Number 5 Region: 619-727
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 304-388
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000366
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397654245|ref|YP_006494928.1|
Sequence length 767
Comment polynucleotide phosphorylase/polyadenylase [Corynebacterium ulcerans 0102]
Sequence
MTVVRRNIHEETCTLSKAKNIEFNVDEEFGITEAIATIDNGDFGTRTIRFETGQLAKQAD
GSVTTYLDDETMLLATTTASNQPREGFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTE
AILACRLIDRPLRPTFVKGLRNEVQVVITVLSMNPEDYYDVVAINGASAATQLSGLPVSG
AVGGVRMALIADEAHPKGQWIAFPTHEQHEKALFELVVAGRLVAKKQGRKTVEDVAIMMV
EAGATENVVEKIKDGAPAPTEEIVAQGLEAAKPFIEVLCRAQAGLAERAAKETQEFPLFP
PYSDVIYDAVEKKVSKKLRQLLTIKSKQERDDATNDYMESIEGELLAKFGSEDEAAASKA
IRAAYNAVMKKLVRHMILTEHFRIDGRGVTDIRDLGVEVELIPRAHGSALFERGETQILG
VTTLDMLKMEQQIDSLSPTSSKRYIHHYNFPPYSTGETGRVGSPKRREIGHGALAERALM
PVIPSREEFPYTIRQVSEALGSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSDE
VDGETRYVALTDILGAEDAFGDMDFKVAGTRDFVTALQLDTKLDGIPSKVLASALAQAYE
AREAILDTMAEVIESPDAMSDYAPRITTVTVPVSKIGEVIGPKGKTINSITEETGANISI
EEDGTVYVSATSGAAAEAAIEKINAIANPQLPKVGERFLGTIVKTTAFGAFVSLVPGRDG
LIHISKLGNGKRIEKVEDVVNVGDKVEVEILDIDNRGKISLAPVKED
Download sequence
Identical sequences gi|384515898|ref|YP_005710990.1| gi|337290985|ref|YP_004630006.1| WP_013911737.1.12475 WP_013911737.1.41020 WP_013911737.1.45382 WP_013911737.1.83743 WP_013911737.1.91675 WP_013911737.1.96929 gi|397654245|ref|YP_006494928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]