SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407702881|ref|YP_006816029.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407702881|ref|YP_006816029.1|
Domain Number 1 Region: 13-407
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.13e-97
Family Amylase, catalytic domain 0.000000000108
Further Details:      
 
Domain Number 2 Region: 410-495
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.8e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00033
Further Details:      
 
Domain Number 3 Region: 584-684
Classification Level Classification E-value
Superfamily Starch-binding domain-like 6.62e-16
Family Starch-binding domain 0.0000768
Further Details:      
 
Domain Number 4 Region: 499-575
Classification Level Classification E-value
Superfamily E set domains 0.0000000000196
Family E-set domains of sugar-utilizing enzymes 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407702881|ref|YP_006816029.1|
Sequence length 694
Comment cyclomaltodextrin glucanotransferase [Bacillus thuringiensis MC28]
Sequence
MKEKDRLKFSRSSVNFSKDIIYQIVTDRFFNGCPSYNPKGELYDESRRNKKKYFGGDWIG
IIEKLNANYFTELGVTSLWISQPVENIFTPINDLVGSTSYHGYWARDFKRTNPFFGTFED
FQTLIKTAHAKDIKVIMDFAPNHTSPALHNDATYAENGRLYDDGLLLAGYDNDYNHYFHH
NGGTDFEEYEDGVYRNLFDLADLNHQNIVIDLYFKEAIKLWLDQGIDGIRVDAVKHMSYG
WQKSWLNSIYNHRPVFIFGEWYINPNEYDHRNIHFANNSGMSLLDFSFAHKVREVFRDGI
DSIYGLHKMIEETYQTYNDANNLVTFIDNHDMDRFHMNGQSKRGIEQSLVFLLTSRGIPS
IYYGTEQYMVGNGDPNNRGQMESFDVNTDNFKIIQALSSLRRLNNALPYGTTKERYITDD
LYVYERCFGSDVVLIALNRNLTEGYEIKDVKTALPSRKYKDILEGLLDGEVITVENNSIN
SLWLGPGSVHVWHHKGVNSLPLIGTVGHKMTMVGQIICIDGCGFTSKKGSVFFEEEEAEV
ISWSHTSIQVKVPVVNDGKYGITVVTDKGTRSNIYKHVEVLNKKQVCIRFVIENGYEIPE
SEVFIMGNTYSLGDMNPCKAVGPFFNQIMYQFPTGYFDISVPADTLLEFKFIRRVNKKLL
IEGGENHRYQTPRFGTGEVVVKWQTAEKTILVET
Download sequence
Identical sequences K0G7T3
gi|407702881|ref|YP_006816029.1|NC_018689 gi|407702881|ref|YP_006816029.1| WP_000659532.1.11380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]