SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407703092|ref|YP_006816240.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407703092|ref|YP_006816240.1|
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0596
Family Coronavirus S2 glycoprotein 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407703092|ref|YP_006816240.1|
Sequence length 100
Comment hypothetical protein MC28_G268 [Bacillus thuringiensis MC28]
Sequence
MENKEILLAITELKSSIDKRFDALEKQFDKRLDSVSEELYKIKQNLVTVDGQQSEDTQKQ
IDKIEKDIKILNQDVMFLAGKLGVHDLKLIGIENKTYIKR
Download sequence
Identical sequences K0G194
WP_000428112.1.11380 WP_000428112.1.24992 WP_000428112.1.499 WP_000428112.1.64770 gi|407703092|ref|YP_006816240.1|NC_018689 gi|407703092|ref|YP_006816240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]