SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340794555|ref|YP_004760018.1| from Corynebacterium variabile DSM 44702

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340794555|ref|YP_004760018.1|
Domain Number 1 Region: 21-269
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-74
Family Cgl1923-like 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340794555|ref|YP_004760018.1|
Sequence length 334
Comment proteasome assembly chaperone [Corynebacterium variabile DSM 44702]
Sequence
MSENDRMYELEYPAPGIGDGIGGVPLVIALQGYADAGQGVQQASQHLLQALEHNPVATFD
VDALIDYRSRRPGVTIDRSRLTGSEDLSLTLHRLEDSAGHPFLLLEGPEPDLRWNAFSRA
VTELSTSLRVDRSVALYAAPMTVPHTRPLVVSAHASDPTLVADLQRWESRMIIPGSAALR
TELSLSSAGVDTVGLTAHVPHYIAASDYPEAAYGLLHAVEQVGDLELPLRALQTDMEKVR
SQLAEQVEESGEIGTVVAALERQYDEEMARMRRRRENSLLAPGENVPSGEELGAEFERFL
AGMSGDSDSEGSDGDAGTDPSTGTGDPTDGDRDA
Download sequence
Identical sequences A0A0X2NL70 G0HEF9
gi|340794555|ref|YP_004760018.1| WP_014010110.1.39090 WP_014010110.1.93856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]