SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Galma1|133901|gm1.2402_g from Galerina marginata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Galma1|133901|gm1.2402_g
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily TPR-like 2.11e-20
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 2 Region: 170-204,254-329
Classification Level Classification E-value
Superfamily SET domain 1.44e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Galma1|133901|gm1.2402_g
Sequence length 458
Sequence
MTLQINPMGTTTFNVAELAKRKGNAAFVAKDYVTAKSLYTYAMAIDQLNHVYPLNRSMAN
LQLARWDEAEVDATTALHLAPDTLKALFRRGRARRGLGNWAQARNDIQMFIDHGGDLSDG
AQELKAIADAESLLPPETFSTSANLNDTLANLECAGGPSSFVVHASAIVQSGEGAFASRE
FQRGELILSEKPLFSVQNVVPERQKLAFIQEKVRNLSPTHLDRFLSLHNSHTNCSCYPNL
ALGIYGTNAFALSDESGICLKASKFNHSCSPNARHSFNAITGECRIYALVTIPVGEEIFI
TYISGRKQYGETRLSRQNLLSVRHFTCACSVCSLPEAESKLSDARRVMLNELWESIPSFL
PTQGAQRLRVIVKGIHLLKEEGYMADADDFSNDAGAVCAYHSDWVSTKYWTHFTYQTRVA
EFGENSPRAREVRDAYLNPHSIPMAGQGPPKKFTTIRV
Download sequence
Identical sequences A0A067TN51
jgi|Galma1|133901|gm1.2402_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]