SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Galma1|222027|fgenesh1_pm.4_#_831 from Galerina marginata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Galma1|222027|fgenesh1_pm.4_#_831
Domain Number 1 Region: 533-832
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.09e-64
Family PIWI domain 0.013
Further Details:      
 
Domain Number 2 Region: 250-405
Classification Level Classification E-value
Superfamily PAZ domain 5.81e-26
Family PAZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Galma1|222027|fgenesh1_pm.4_#_831
Sequence length 935
Sequence
MPPRGAPGRAGHPRGGANPPQGGRGGGAVRGSQPSGLPAAHVNAVGLKRPNFGTAGRRIQ
VQVNSFAITAIPQGRIFHYDGRSSSLYKLPARFNMELFKILQSEETEVFTPKIVYDGRKI
AFAPRELPLGESRRFPVTLPQANGGGNPTRQPRIYYITLKKVAEIDVELLERYIMGQQST
EEKILMAITALNVVLRMEPNLNYPFNRRSFYTPQETRNIGGGLTLWRGIFQSIRPTIGRL
VVNVDLATGVMYKEGRLLDLCIEFFNRPQGTNPRFLSPVHNFSERDRHRLARFLTGLRVL
VSTTGNKTRTIRGLSSVGADTYEFATHAGNTTTVAQYFQSLGRPLQCPTVGSTAMIPLEM
CTVPRGQIMRKQVPDDKVKDVLEFSTLRPDARLDSIRRGIQNLQYGQSDYVRQFGMAIDT
EPLKVDVRVLNPPKLKYGSQSRQPTVVSPSIDKKFFEPAAIARWAMVVYESPNRFPDAAC
RDAVNGFLAACASVGVQVATREPLIKYQHGQGSVEAHLKAVGAECNARLGGFPSLLVVIL
PDGGNDIYTAVKQYVGIPTQCLKSNKCGRAKPQYWANVLLKVNPKMGGINVIPDASVAVL
SDPLNPTIIMGADVIHPAPGATDRPSFTAVVGSVDSHSAKYVTTSRAQTGRQEIINDLKD
MCKDILGLYKGYRQNVEKQKQLNPKRLIFYRDGVSEGQFKHVLELVFLMLNPEACKEMGM
NPQITLVIVGKRHHNQLFPPGNIADRSGNSPAGSVIDTGIAHPTDFDFILQSHAGLLGTS
QPGHYTVLADSIQALSFALCHVYARSTRSVSIPAPVYYADIVCARAKNHFDPQGNLDLTD
TSTQASASGAGPGGLEAYKLGYKPLHQNQRTKMYFMLDIVYYYASSVVMPKFSPEPKFEP
ELLEPNAKFSSKFSKGTEPNVKSSSRFRLGGGVRT
Download sequence
Identical sequences A0A067TIG9
jgi|Galma1|222027|fgenesh1_pm.4_#_831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]