SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488599882|ref|YP_007906353.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488599882|ref|YP_007906353.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000334
Family GHMP Kinase, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488599882|ref|YP_007906353.1|
Sequence length 274
Comment putative archaeal kinase (sugar kinase superfamily) [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MTFFAPASITAFFSPKISDDPLKSGSTGVGITLSKGVKAELSDDRIRLNGRDFSFPTIEL
LFEKLGLELKQGLKLESQIPVGCGFGFSGAACLAAAFEINKKMKLKKGYFELTDIVHECE
VESRTGLGDVVCQSYGGVVVRKVAGSPSMVKIEKYLFNDDLSFLVIGEIQTSKILRDDEI
VQRINRYGEEALKAFLRNPEMENLFRISKEFAVKTGLMDDEVLEIIKDLERQGYLASMVM
LGKVVFSNCDVEILKEYGEKTLKARISQVGVVEV
Download sequence
Identical sequences N0BJN6
gi|488599882|ref|YP_007906353.1| WP_015589959.1.93643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]