SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488600655|ref|YP_007907126.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488600655|ref|YP_007907126.1|
Domain Number 1 Region: 33-87,170-351
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.79e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|488600655|ref|YP_007907126.1|
Domain Number - Region: 119-155
Classification Level Classification E-value
Superfamily EF-hand 0.0667
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488600655|ref|YP_007907126.1|
Sequence length 538
Comment phosphoserine-tRNA(Cys) ligase [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MRFDVNEYKKLSEEDFEKAWMKGTEVLTPKNPNLLFPRYSYSIGEEHPLFKTINDLRRAY
ITLGFKEVVNPVIVEDSHVRRQFGKEALAVLDRCFYLASLPRPNIGISAEKVDEIEKIAQ
KKLSEEEIDAIRMIFHEFKKGRIDGDDLPYKLASAIEISDVKAVEIIDKVFPEFKALKPE
PESLTLRSHMTTGWFITLSKIASRFPLPIKLFSIDRCFRKEQREDATRLYTYFSASCVVV
DEDVGVEEGKAVAEGLLRQFGFKKFKFRLDEKRSKYYIPGTQTEVFAFHPKIVGSSTKYS
DGWIEIATFGIYSPTALAQYDVEYPVMNLGLGVERLAMILYDYSDVRELVYPWLYGKIEL
SDMDIAKGIKLLEVPYTLDGLKIAQSIIECADKNKDIRGPAEVTAFEGEIYGKKIRVKIV
EREENVRLCGPAYANEVVVYQGSILGVPRTDKWLHVFEHGFTTGIRYIDSFAHYCARKIE
EGVAKDVKEMEIRTRVVESLSDINLGLQENIRKYITSKEGKIDIRGPMFVAVRYEMLS
Download sequence
Identical sequences N0BDQ3
WP_015590731.1.93643 gi|488600655|ref|YP_007907126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]