SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488601245|ref|YP_007907716.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|488601245|ref|YP_007907716.1|
Domain Number - Region: 41-99
Classification Level Classification E-value
Superfamily EF-hand 0.00911
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number - Region: 99-146
Classification Level Classification E-value
Superfamily RING/U-box 0.0102
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Domain Number - Region: 4-27
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0314
Family Rubredoxin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488601245|ref|YP_007907716.1|
Sequence length 155
Comment hypothetical protein Asulf_01752 [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MVKLCKICGEEIVGGKFEDYETCPICGDILDDIIAKYLEMVAMKCAQQEFDGITLNMIIK
YLDEVVDWVEFFEDLEEFSSDAKYYERFRMVLNKLDLDRVWFEKIIKENYKTCPACGADF
TRQCLDIEKDGDWVKVYCGTCGKLISKHYAPKTEL
Download sequence
Identical sequences N0BFC2
WP_015591321.1.93643 gi|488601245|ref|YP_007907716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]