SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384124783|ref|YP_005507397.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384124783|ref|YP_005507397.1|
Domain Number 1 Region: 2-250,361-416
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-70
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 444-583
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 7.46e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.000000553
Further Details:      
 
Domain Number 3 Region: 227-358
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.79e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384124783|ref|YP_005507397.1|
Sequence length 607
Comment fumarate reductase [Yersinia pestis D182038]
Sequence
MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSHTVAAEGGSAAVTQDH
DTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPWSRKEDGSVNVRRFGGM
KIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILVDEGQARGVVAMNMMEGT
RVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGVPLRDMEFVQYHPTGLPGS
GILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
AGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
GIETNPQCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRVAGEQAALRAMESGP
ANGSALDAQTRDVETRLSNLMKQEGTENWSKIRDEMGLSMEEGCGIYRTPELMQKTVDKL
AELKERFKRVKITDHSSVFNTDLLYTIELGYGLDVAECMAHSALNRKESRGAHQRLDEGC
TERDDVNFLKHTLAFHTPGGAPRIEYSDVKITKLVPAKRVYGGEATAQDAKDAKDAQDLK
DKEQAND
Download sequence
Identical sequences A0A0E1NXH9 A0A0H2YLL7 A0A0H3B898 A0A0M1VC64 A0A0U1EWF9 A0A0U1R1W7 A0A208S8Z7 A0A2A7VK87 Q0WJV0 Q66FC7 Q7CKM6
IDP02190 gi|294502470|ref|YP_003566532.1| gi|384137660|ref|YP_005520362.1| gi|22124531|ref|NP_667954.1| 187410.y0617 214092.YPO0360 229193.YP_0515 273123.YPTB0413 349746.YpAngola_A0714 349747.YpsIP31758_3667 360102.YPA_3923 377628.YPN_3311 386656.YPDSF_3614 502800.YPK_3813 502801.YPTS_0439 gi|51594765|ref|YP_068956.1| gi|384120904|ref|YP_005503524.1| gi|162419007|ref|YP_001605292.1| gi|145600861|ref|YP_001164937.1| gi|186893772|ref|YP_001870884.1| gi|384413271|ref|YP_005622633.1| gi|218927563|ref|YP_002345438.1| gi|153950267|ref|YP_001402621.1| gi|384124783|ref|YP_005507397.1| gi|108809913|ref|YP_653829.1| gi|45440369|ref|NP_991908.1| WP_002209137.1.100083 WP_002209137.1.100246 WP_002209137.1.100921 WP_002209137.1.100931 WP_002209137.1.10105 WP_002209137.1.101382 WP_002209137.1.101928 WP_002209137.1.102012 WP_002209137.1.102067 WP_002209137.1.10736 WP_002209137.1.10935 WP_002209137.1.10955 WP_002209137.1.11693 WP_002209137.1.12167 WP_002209137.1.12463 WP_002209137.1.12857 WP_002209137.1.1388 WP_002209137.1.14063 WP_002209137.1.14169 WP_002209137.1.14804 WP_002209137.1.15321 WP_002209137.1.15555 WP_002209137.1.15605 WP_002209137.1.15689 WP_002209137.1.16243 WP_002209137.1.16333 WP_002209137.1.17135 WP_002209137.1.17141 WP_002209137.1.17608 WP_002209137.1.17873 WP_002209137.1.17983 WP_002209137.1.18208 WP_002209137.1.18640 WP_002209137.1.18826 WP_002209137.1.19329 WP_002209137.1.19425 WP_002209137.1.19739 WP_002209137.1.20380 WP_002209137.1.20547 WP_002209137.1.2064 WP_002209137.1.21784 WP_002209137.1.21879 WP_002209137.1.21934 WP_002209137.1.22530 WP_002209137.1.22542 WP_002209137.1.22708 WP_002209137.1.23271 WP_002209137.1.23687 WP_002209137.1.23811 WP_002209137.1.24002 WP_002209137.1.2451 WP_002209137.1.25181 WP_002209137.1.25394 WP_002209137.1.26383 WP_002209137.1.26776 WP_002209137.1.27124 WP_002209137.1.27251 WP_002209137.1.2726 WP_002209137.1.28647 WP_002209137.1.28922 WP_002209137.1.29157 WP_002209137.1.29355 WP_002209137.1.2947 WP_002209137.1.29622 WP_002209137.1.2964 WP_002209137.1.29685 WP_002209137.1.29814 WP_002209137.1.3092 WP_002209137.1.30931 WP_002209137.1.311 WP_002209137.1.31336 WP_002209137.1.31496 WP_002209137.1.31739 WP_002209137.1.31805 WP_002209137.1.32343 WP_002209137.1.32388 WP_002209137.1.32446 WP_002209137.1.32736 WP_002209137.1.33203 WP_002209137.1.33324 WP_002209137.1.33661 WP_002209137.1.33937 WP_002209137.1.34031 WP_002209137.1.34138 WP_002209137.1.35389 WP_002209137.1.35538 WP_002209137.1.36088 WP_002209137.1.37174 WP_002209137.1.37494 WP_002209137.1.37863 WP_002209137.1.38147 WP_002209137.1.38235 WP_002209137.1.38532 WP_002209137.1.38743 WP_002209137.1.38824 WP_002209137.1.38993 WP_002209137.1.39066 WP_002209137.1.39346 WP_002209137.1.3976 WP_002209137.1.39858 WP_002209137.1.40071 WP_002209137.1.40134 WP_002209137.1.40853 WP_002209137.1.41196 WP_002209137.1.4210 WP_002209137.1.42361 WP_002209137.1.42490 WP_002209137.1.42976 WP_002209137.1.44408 WP_002209137.1.44603 WP_002209137.1.44832 WP_002209137.1.45198 WP_002209137.1.45214 WP_002209137.1.46262 WP_002209137.1.46697 WP_002209137.1.46731 WP_002209137.1.4678 WP_002209137.1.46891 WP_002209137.1.47387 WP_002209137.1.47440 WP_002209137.1.47769 WP_002209137.1.48166 WP_002209137.1.48722 WP_002209137.1.4889 WP_002209137.1.49315 WP_002209137.1.49906 WP_002209137.1.50093 WP_002209137.1.50185 WP_002209137.1.50984 WP_002209137.1.51284 WP_002209137.1.51293 WP_002209137.1.51772 WP_002209137.1.51934 WP_002209137.1.52158 WP_002209137.1.52247 WP_002209137.1.52473 WP_002209137.1.52734 WP_002209137.1.52792 WP_002209137.1.52819 WP_002209137.1.52969 WP_002209137.1.53300 WP_002209137.1.53838 WP_002209137.1.53848 WP_002209137.1.53883 WP_002209137.1.53953 WP_002209137.1.54568 WP_002209137.1.54951 WP_002209137.1.55194 WP_002209137.1.55695 WP_002209137.1.5592 WP_002209137.1.56031 WP_002209137.1.56912 WP_002209137.1.56953 WP_002209137.1.57585 WP_002209137.1.57657 WP_002209137.1.58067 WP_002209137.1.58543 WP_002209137.1.58794 WP_002209137.1.59431 WP_002209137.1.5957 WP_002209137.1.59687 WP_002209137.1.59789 WP_002209137.1.59885 WP_002209137.1.60437 WP_002209137.1.60707 WP_002209137.1.60896 WP_002209137.1.61689 WP_002209137.1.62232 WP_002209137.1.6270 WP_002209137.1.6333 WP_002209137.1.63387 WP_002209137.1.63641 WP_002209137.1.64474 WP_002209137.1.64780 WP_002209137.1.653 WP_002209137.1.65400 WP_002209137.1.65554 WP_002209137.1.6570 WP_002209137.1.65706 WP_002209137.1.65718 WP_002209137.1.6581 WP_002209137.1.66118 WP_002209137.1.66546 WP_002209137.1.66616 WP_002209137.1.67404 WP_002209137.1.67850 WP_002209137.1.6791 WP_002209137.1.68361 WP_002209137.1.68371 WP_002209137.1.68753 WP_002209137.1.68855 WP_002209137.1.69316 WP_002209137.1.69951 WP_002209137.1.70117 WP_002209137.1.70319 WP_002209137.1.70377 WP_002209137.1.70417 WP_002209137.1.70726 WP_002209137.1.7083 WP_002209137.1.7169 WP_002209137.1.71744 WP_002209137.1.72280 WP_002209137.1.72440 WP_002209137.1.72486 WP_002209137.1.7402 WP_002209137.1.74131 WP_002209137.1.74310 WP_002209137.1.74577 WP_002209137.1.74738 WP_002209137.1.75173 WP_002209137.1.7518 WP_002209137.1.75208 WP_002209137.1.75337 WP_002209137.1.75407 WP_002209137.1.75636 WP_002209137.1.75821 WP_002209137.1.76670 WP_002209137.1.77387 WP_002209137.1.77429 WP_002209137.1.77691 WP_002209137.1.78004 WP_002209137.1.7841 WP_002209137.1.78556 WP_002209137.1.79515 WP_002209137.1.79550 WP_002209137.1.79609 WP_002209137.1.8009 WP_002209137.1.81877 WP_002209137.1.8210 WP_002209137.1.82133 WP_002209137.1.82151 WP_002209137.1.82270 WP_002209137.1.82436 WP_002209137.1.8303 WP_002209137.1.83039 WP_002209137.1.83265 WP_002209137.1.83630 WP_002209137.1.84703 WP_002209137.1.85269 WP_002209137.1.85270 WP_002209137.1.8559 WP_002209137.1.85802 WP_002209137.1.86034 WP_002209137.1.86413 WP_002209137.1.87107 WP_002209137.1.8728 WP_002209137.1.87418 WP_002209137.1.8762 WP_002209137.1.87853 WP_002209137.1.87988 WP_002209137.1.88362 WP_002209137.1.88472 WP_002209137.1.89359 WP_002209137.1.89542 WP_002209137.1.8964 WP_002209137.1.90176 WP_002209137.1.9051 WP_002209137.1.90624 WP_002209137.1.91263 WP_002209137.1.91373 WP_002209137.1.91844 WP_002209137.1.92030 WP_002209137.1.92331 WP_002209137.1.92604 WP_002209137.1.927 WP_002209137.1.9311 WP_002209137.1.93623 WP_002209137.1.93928 WP_002209137.1.93933 WP_002209137.1.94052 WP_002209137.1.94201 WP_002209137.1.94545 WP_002209137.1.94683 WP_002209137.1.95746 WP_002209137.1.95981 WP_002209137.1.97245 WP_002209137.1.97375 WP_002209137.1.97448 WP_002209137.1.97791 WP_002209137.1.97864 WP_002209137.1.97872 WP_002209137.1.97894 WP_002209137.1.99109 WP_002209137.1.99383 WP_002209137.1.9941 WP_002209137.1.99416 WP_002209137.1.99788 WP_002209137.1.99882 WP_002209137.1.99990 YP_002345438.1.25044 gi|170026027|ref|YP_001722532.1| gi|108813471|ref|YP_649238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]