SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384125169|ref|YP_005507783.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384125169|ref|YP_005507783.1|
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.29e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Domain Number 2 Region: 132-196,262-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000466
Family FAD/NAD-linked reductases, N-terminal and central domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384125169|ref|YP_005507783.1|
Sequence length 442
Comment putative siderophore biosynthesis protein IucD [Yersinia pestis D182038]
Sequence
MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPGMMVPDCHMQTCFLKD
LVSTVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLRWAASGMSSLEFSQDIQ
SVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQNDRCFHASEMALRNPDLT
GKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNALDEAAFANEYFMPEYVES
FYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEVLHEKPWARLLPSRSLTNMH
TRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFLDPLADRLQTTADCQYQVAPD
FVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAHILNRALGRTQFDLTSTPAVIQ
WRSQQSGVPAHPEHPVLNCIDI
Download sequence
Identical sequences A0A0E1NPY0 A0A0H2YKF7 A0A0M1V3W5 A0A208RTT8 Q0WI50 Q7CGN7
gi|384125169|ref|YP_005507783.1| gi|108806269|ref|YP_650185.1| gi|22127260|ref|NP_670683.1| WP_002211647.1.100246 WP_002211647.1.100931 WP_002211647.1.10105 WP_002211647.1.101305 WP_002211647.1.101382 WP_002211647.1.101928 WP_002211647.1.102012 WP_002211647.1.102067 WP_002211647.1.10955 WP_002211647.1.12463 WP_002211647.1.12857 WP_002211647.1.14063 WP_002211647.1.14804 WP_002211647.1.15321 WP_002211647.1.15605 WP_002211647.1.15689 WP_002211647.1.16333 WP_002211647.1.17135 WP_002211647.1.17873 WP_002211647.1.17983 WP_002211647.1.18640 WP_002211647.1.18826 WP_002211647.1.19739 WP_002211647.1.20035 WP_002211647.1.2064 WP_002211647.1.21486 WP_002211647.1.21879 WP_002211647.1.21934 WP_002211647.1.22530 WP_002211647.1.22542 WP_002211647.1.22708 WP_002211647.1.23157 WP_002211647.1.23271 WP_002211647.1.23811 WP_002211647.1.24002 WP_002211647.1.25394 WP_002211647.1.2640 WP_002211647.1.26776 WP_002211647.1.26960 WP_002211647.1.27251 WP_002211647.1.2726 WP_002211647.1.28647 WP_002211647.1.28922 WP_002211647.1.29157 WP_002211647.1.2947 WP_002211647.1.31739 WP_002211647.1.31805 WP_002211647.1.32343 WP_002211647.1.32388 WP_002211647.1.32446 WP_002211647.1.33937 WP_002211647.1.34031 WP_002211647.1.35389 WP_002211647.1.35538 WP_002211647.1.36088 WP_002211647.1.37863 WP_002211647.1.38147 WP_002211647.1.38743 WP_002211647.1.39066 WP_002211647.1.39346 WP_002211647.1.40071 WP_002211647.1.40134 WP_002211647.1.40853 WP_002211647.1.41196 WP_002211647.1.42490 WP_002211647.1.44598 WP_002211647.1.44603 WP_002211647.1.44832 WP_002211647.1.45214 WP_002211647.1.46262 WP_002211647.1.46545 WP_002211647.1.46686 WP_002211647.1.4678 WP_002211647.1.46891 WP_002211647.1.47387 WP_002211647.1.48166 WP_002211647.1.48722 WP_002211647.1.4889 WP_002211647.1.49906 WP_002211647.1.4997 WP_002211647.1.50010 WP_002211647.1.50093 WP_002211647.1.50106 WP_002211647.1.50984 WP_002211647.1.51293 WP_002211647.1.51588 WP_002211647.1.51934 WP_002211647.1.52158 WP_002211647.1.52247 WP_002211647.1.52734 WP_002211647.1.52819 WP_002211647.1.53300 WP_002211647.1.53838 WP_002211647.1.53848 WP_002211647.1.53953 WP_002211647.1.54568 WP_002211647.1.54951 WP_002211647.1.55194 WP_002211647.1.5592 WP_002211647.1.56912 WP_002211647.1.56953 WP_002211647.1.57657 WP_002211647.1.58067 WP_002211647.1.58794 WP_002211647.1.59102 WP_002211647.1.59431 WP_002211647.1.5957 WP_002211647.1.59635 WP_002211647.1.59687 WP_002211647.1.59789 WP_002211647.1.60437 WP_002211647.1.61689 WP_002211647.1.62232 WP_002211647.1.62342 WP_002211647.1.63387 WP_002211647.1.64142 WP_002211647.1.64474 WP_002211647.1.64780 WP_002211647.1.64786 WP_002211647.1.64910 WP_002211647.1.653 WP_002211647.1.65400 WP_002211647.1.65554 WP_002211647.1.65718 WP_002211647.1.6581 WP_002211647.1.66118 WP_002211647.1.66546 WP_002211647.1.66616 WP_002211647.1.67404 WP_002211647.1.68361 WP_002211647.1.68855 WP_002211647.1.69018 WP_002211647.1.69316 WP_002211647.1.69951 WP_002211647.1.70171 WP_002211647.1.70319 WP_002211647.1.70377 WP_002211647.1.70417 WP_002211647.1.70726 WP_002211647.1.7083 WP_002211647.1.7169 WP_002211647.1.71744 WP_002211647.1.72440 WP_002211647.1.74577 WP_002211647.1.75173 WP_002211647.1.7518 WP_002211647.1.75407 WP_002211647.1.75689 WP_002211647.1.75821 WP_002211647.1.77387 WP_002211647.1.77429 WP_002211647.1.77691 WP_002211647.1.7841 WP_002211647.1.78556 WP_002211647.1.79515 WP_002211647.1.79550 WP_002211647.1.79609 WP_002211647.1.79981 WP_002211647.1.80331 WP_002211647.1.81848 WP_002211647.1.81877 WP_002211647.1.8210 WP_002211647.1.82151 WP_002211647.1.82619 WP_002211647.1.8303 WP_002211647.1.8420 WP_002211647.1.84703 WP_002211647.1.84720 WP_002211647.1.85269 WP_002211647.1.85270 WP_002211647.1.8559 WP_002211647.1.85802 WP_002211647.1.86034 WP_002211647.1.86413 WP_002211647.1.8728 WP_002211647.1.87418 WP_002211647.1.87853 WP_002211647.1.87988 WP_002211647.1.88362 WP_002211647.1.88472 WP_002211647.1.8964 WP_002211647.1.90176 WP_002211647.1.9051 WP_002211647.1.91844 WP_002211647.1.92331 WP_002211647.1.92604 WP_002211647.1.927 WP_002211647.1.9311 WP_002211647.1.9320 WP_002211647.1.93928 WP_002211647.1.93933 WP_002211647.1.94052 WP_002211647.1.94545 WP_002211647.1.94683 WP_002211647.1.97245 WP_002211647.1.97375 WP_002211647.1.97448 WP_002211647.1.97791 WP_002211647.1.97872 WP_002211647.1.97894 WP_002211647.1.99109 WP_002211647.1.99383 WP_002211647.1.99416 WP_002211647.1.99788 WP_002211647.1.99990 YP_002346038.1.25044 gi|108813351|ref|YP_649118.1| 187410.y3384 214092.YPO0993 360102.YPA_0271 377628.YPN_3191 gi|384413416|ref|YP_005622778.1| gi|294502855|ref|YP_003566917.1| gi|218928163|ref|YP_002346038.1| gi|384121292|ref|YP_005503912.1| gi|384137009|ref|YP_005519711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]