SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384125236|ref|YP_005507850.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384125236|ref|YP_005507850.1|
Domain Number 1 Region: 2-175,265-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.46e-55
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384125236|ref|YP_005507850.1|
Sequence length 392
Comment 2-octaprenyl-6-methoxyphenyl hydroxylase [Yersinia pestis D182038]
Sequence
MSVIIVGGGMAGVTLALAISSLTHGQVPVALVEAQQPNDRQHPGFDARAIALAQGTCQQL
ARIGAWSALADCATAIDHVHVSDRGHSGFVNLRAEDYGVPALGHVLELHDAGERLFALLM
KAPGVTLHCPAKVVDVVRTAESARVTLDDGQQLAAKLLVAADGSHSALAQSCAIQWQRQD
YQQVAIIANITTSELPNGRAFERFTRNGPLALLPMSQGRSSLVWCHAKHDQQQIDSWDDA
RFLAELQQAFGWRLGKMLQAGKRHSYPLQLLIASRHISHRLALVGNAAQTLHPIAGQGFN
LGLRDVMSLAETLAEAAAMGNDLGDYTVLSHYQQRRQQDQQATIGVTDGLIRLFANRYGP
LVAGRNLALMAMEQMPTIRDTFARRTLGWVER
Download sequence
Identical sequences A0A0E1NM37 A0A0H2W9G7 A0A0H2YM39 A0A0H3B049 A0A0M1V9W1 A0A0U1ERP5 A0A208S2J8 A0A2A7VIX7 Q7CGT0
187410.y3296 214092.YPO0909 229193.YP_3606 349746.YpAngola_A3828 360102.YPA_0358 377628.YPN_3108 386656.YPDSF_0605 502800.YPK_0864 502801.YPTS_3316 WP_002209951.1.100083 WP_002209951.1.100246 WP_002209951.1.100921 WP_002209951.1.100931 WP_002209951.1.10105 WP_002209951.1.101305 WP_002209951.1.101382 WP_002209951.1.101928 WP_002209951.1.102012 WP_002209951.1.102067 WP_002209951.1.10736 WP_002209951.1.10935 WP_002209951.1.10955 WP_002209951.1.11693 WP_002209951.1.12463 WP_002209951.1.12736 WP_002209951.1.12857 WP_002209951.1.1388 WP_002209951.1.14063 WP_002209951.1.14804 WP_002209951.1.15321 WP_002209951.1.15555 WP_002209951.1.15605 WP_002209951.1.15689 WP_002209951.1.16243 WP_002209951.1.16333 WP_002209951.1.17135 WP_002209951.1.17141 WP_002209951.1.17608 WP_002209951.1.17873 WP_002209951.1.17983 WP_002209951.1.18208 WP_002209951.1.18640 WP_002209951.1.18826 WP_002209951.1.19425 WP_002209951.1.19739 WP_002209951.1.19763 WP_002209951.1.20380 WP_002209951.1.20547 WP_002209951.1.2064 WP_002209951.1.20932 WP_002209951.1.21486 WP_002209951.1.21784 WP_002209951.1.21879 WP_002209951.1.21934 WP_002209951.1.22530 WP_002209951.1.22542 WP_002209951.1.22708 WP_002209951.1.23157 WP_002209951.1.23271 WP_002209951.1.23687 WP_002209951.1.23811 WP_002209951.1.24002 WP_002209951.1.2451 WP_002209951.1.25181 WP_002209951.1.25394 WP_002209951.1.2640 WP_002209951.1.26776 WP_002209951.1.26960 WP_002209951.1.27124 WP_002209951.1.27251 WP_002209951.1.2726 WP_002209951.1.28647 WP_002209951.1.28922 WP_002209951.1.29157 WP_002209951.1.29355 WP_002209951.1.2947 WP_002209951.1.29622 WP_002209951.1.2964 WP_002209951.1.29685 WP_002209951.1.29814 WP_002209951.1.30931 WP_002209951.1.311 WP_002209951.1.31496 WP_002209951.1.31739 WP_002209951.1.31805 WP_002209951.1.32343 WP_002209951.1.32388 WP_002209951.1.32446 WP_002209951.1.32736 WP_002209951.1.33203 WP_002209951.1.33324 WP_002209951.1.33661 WP_002209951.1.33937 WP_002209951.1.34031 WP_002209951.1.35389 WP_002209951.1.35538 WP_002209951.1.36088 WP_002209951.1.37494 WP_002209951.1.37863 WP_002209951.1.38147 WP_002209951.1.38235 WP_002209951.1.38743 WP_002209951.1.38824 WP_002209951.1.38993 WP_002209951.1.39066 WP_002209951.1.39346 WP_002209951.1.3976 WP_002209951.1.39858 WP_002209951.1.40071 WP_002209951.1.40134 WP_002209951.1.40534 WP_002209951.1.40853 WP_002209951.1.41196 WP_002209951.1.4210 WP_002209951.1.42361 WP_002209951.1.42490 WP_002209951.1.42976 WP_002209951.1.44408 WP_002209951.1.44598 WP_002209951.1.44603 WP_002209951.1.44832 WP_002209951.1.45198 WP_002209951.1.45214 WP_002209951.1.46262 WP_002209951.1.46545 WP_002209951.1.46686 WP_002209951.1.46697 WP_002209951.1.46731 WP_002209951.1.4678 WP_002209951.1.46891 WP_002209951.1.47387 WP_002209951.1.47440 WP_002209951.1.48166 WP_002209951.1.48722 WP_002209951.1.4889 WP_002209951.1.49315 WP_002209951.1.49906 WP_002209951.1.4997 WP_002209951.1.50010 WP_002209951.1.50093 WP_002209951.1.50106 WP_002209951.1.50984 WP_002209951.1.51284 WP_002209951.1.51293 WP_002209951.1.51588 WP_002209951.1.51772 WP_002209951.1.51934 WP_002209951.1.52158 WP_002209951.1.52247 WP_002209951.1.52734 WP_002209951.1.52792 WP_002209951.1.52819 WP_002209951.1.52969 WP_002209951.1.53300 WP_002209951.1.53838 WP_002209951.1.53848 WP_002209951.1.53883 WP_002209951.1.53953 WP_002209951.1.54568 WP_002209951.1.54951 WP_002209951.1.55194 WP_002209951.1.55695 WP_002209951.1.5592 WP_002209951.1.56031 WP_002209951.1.56912 WP_002209951.1.56953 WP_002209951.1.57585 WP_002209951.1.57657 WP_002209951.1.58067 WP_002209951.1.58794 WP_002209951.1.59102 WP_002209951.1.59431 WP_002209951.1.5957 WP_002209951.1.59687 WP_002209951.1.59789 WP_002209951.1.59885 WP_002209951.1.60437 WP_002209951.1.60707 WP_002209951.1.60896 WP_002209951.1.61689 WP_002209951.1.62232 WP_002209951.1.62342 WP_002209951.1.6270 WP_002209951.1.63387 WP_002209951.1.63641 WP_002209951.1.64142 WP_002209951.1.64474 WP_002209951.1.64780 WP_002209951.1.64786 WP_002209951.1.64910 WP_002209951.1.653 WP_002209951.1.65400 WP_002209951.1.65554 WP_002209951.1.6570 WP_002209951.1.65706 WP_002209951.1.65718 WP_002209951.1.6581 WP_002209951.1.66546 WP_002209951.1.66616 WP_002209951.1.67404 WP_002209951.1.67850 WP_002209951.1.6791 WP_002209951.1.68361 WP_002209951.1.68753 WP_002209951.1.68855 WP_002209951.1.69018 WP_002209951.1.69316 WP_002209951.1.69951 WP_002209951.1.70117 WP_002209951.1.70171 WP_002209951.1.70319 WP_002209951.1.70377 WP_002209951.1.70417 WP_002209951.1.70726 WP_002209951.1.7083 WP_002209951.1.7169 WP_002209951.1.71744 WP_002209951.1.72280 WP_002209951.1.72440 WP_002209951.1.72486 WP_002209951.1.7402 WP_002209951.1.74131 WP_002209951.1.74310 WP_002209951.1.74577 WP_002209951.1.74738 WP_002209951.1.75173 WP_002209951.1.7518 WP_002209951.1.75208 WP_002209951.1.75337 WP_002209951.1.75407 WP_002209951.1.75636 WP_002209951.1.75821 WP_002209951.1.76670 WP_002209951.1.77387 WP_002209951.1.77429 WP_002209951.1.77691 WP_002209951.1.78004 WP_002209951.1.7841 WP_002209951.1.78556 WP_002209951.1.79515 WP_002209951.1.79550 WP_002209951.1.79609 WP_002209951.1.79981 WP_002209951.1.8009 WP_002209951.1.80331 WP_002209951.1.81848 WP_002209951.1.81877 WP_002209951.1.8210 WP_002209951.1.82133 WP_002209951.1.82151 WP_002209951.1.82270 WP_002209951.1.82619 WP_002209951.1.8303 WP_002209951.1.83039 WP_002209951.1.83265 WP_002209951.1.83630 WP_002209951.1.8420 WP_002209951.1.84703 WP_002209951.1.84720 WP_002209951.1.85269 WP_002209951.1.85270 WP_002209951.1.8559 WP_002209951.1.85802 WP_002209951.1.86034 WP_002209951.1.86413 WP_002209951.1.87107 WP_002209951.1.8728 WP_002209951.1.87418 WP_002209951.1.8762 WP_002209951.1.87853 WP_002209951.1.87988 WP_002209951.1.88362 WP_002209951.1.88472 WP_002209951.1.89359 WP_002209951.1.8964 WP_002209951.1.90176 WP_002209951.1.9051 WP_002209951.1.90624 WP_002209951.1.91373 WP_002209951.1.91844 WP_002209951.1.92030 WP_002209951.1.92331 WP_002209951.1.92604 WP_002209951.1.927 WP_002209951.1.9311 WP_002209951.1.9320 WP_002209951.1.93928 WP_002209951.1.93933 WP_002209951.1.94052 WP_002209951.1.94201 WP_002209951.1.94545 WP_002209951.1.94683 WP_002209951.1.95746 WP_002209951.1.95981 WP_002209951.1.97245 WP_002209951.1.97375 WP_002209951.1.97448 WP_002209951.1.97791 WP_002209951.1.97864 WP_002209951.1.97872 WP_002209951.1.97894 WP_002209951.1.99109 WP_002209951.1.99383 WP_002209951.1.9941 WP_002209951.1.99416 WP_002209951.1.99788 WP_002209951.1.99882 WP_002209951.1.99990 YP_002345957.1.25044 gi|108813268|ref|YP_649035.1| gi|108806355|ref|YP_650271.1| gi|294502925|ref|YP_003566987.1| gi|384121364|ref|YP_005503984.1| gi|384125236|ref|YP_005507850.1| gi|384137098|ref|YP_005519800.1| gi|145597912|ref|YP_001161988.1| gi|186896616|ref|YP_001873728.1| gi|218928082|ref|YP_002345957.1| gi|170023113|ref|YP_001719618.1| gi|384413508|ref|YP_005622870.1| gi|22127172|ref|NP_670595.1| gi|45443340|ref|NP_994879.1| IDP90879 gi|162420406|ref|YP_001608137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]