SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384125237|ref|YP_005507851.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384125237|ref|YP_005507851.1|
Domain Number 1 Region: 4-180,271-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-61
Family FAD-linked reductases, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384125237|ref|YP_005507851.1|
Sequence length 406
Comment hypothetical protein YPD8_0768 [Yersinia pestis D182038]
Sequence
MQSFDIVIAGGGMVGLALACGLQGSGLRIAIIEHQPAPMPLTAPLTGELALRVSAINAAS
ERLLQKIGVWETIQALRASPYHGMEVWDKDSFGKIAFHADEYGFSHLGHIIENQVIQQAL
WQRASQLPEVTVLAPASFKQVAWGETEAFITLTDDRMLSARLVVGADGAHSWLRQHADIP
LTFWDYAHHALVATIRTDEPHQATARQVFHGDGILAFLPFSDPHLSSIVWSLPPERAAEL
AVLPAEQFNRELAMTFDMRLGQCQLESERQTFPLTGRYARSFAAHRLVLVGDAAHTVHPL
AGQGVNLGFMDVAELVSELRRLQRQGKDIGQHLYLRRYERRRKHSAAMMLASMQGFRDLF
AGNNPAKKLLRDIGLTLADHLPGVKPQLVRQAMGLNDLPEWLERSQ
Download sequence
Identical sequences A0A0E1P0U3 A0A0E8XM45 A0A0M1V9Q0 A0A208S2R1 Q0WID2 Q666R4
gi|161511305|ref|NP_994878.2| WP_002209950.1.100083 WP_002209950.1.100246 WP_002209950.1.100921 WP_002209950.1.100931 WP_002209950.1.10105 WP_002209950.1.101305 WP_002209950.1.101382 WP_002209950.1.101928 WP_002209950.1.102012 WP_002209950.1.102067 WP_002209950.1.10736 WP_002209950.1.10935 WP_002209950.1.10955 WP_002209950.1.11693 WP_002209950.1.12463 WP_002209950.1.12736 WP_002209950.1.12857 WP_002209950.1.1388 WP_002209950.1.14063 WP_002209950.1.14804 WP_002209950.1.15321 WP_002209950.1.15555 WP_002209950.1.15605 WP_002209950.1.15689 WP_002209950.1.16243 WP_002209950.1.16333 WP_002209950.1.17135 WP_002209950.1.17141 WP_002209950.1.17608 WP_002209950.1.17873 WP_002209950.1.17983 WP_002209950.1.18208 WP_002209950.1.18640 WP_002209950.1.18826 WP_002209950.1.19425 WP_002209950.1.19739 WP_002209950.1.20035 WP_002209950.1.2064 WP_002209950.1.21486 WP_002209950.1.21784 WP_002209950.1.21879 WP_002209950.1.21934 WP_002209950.1.22530 WP_002209950.1.22542 WP_002209950.1.22708 WP_002209950.1.23157 WP_002209950.1.23271 WP_002209950.1.23687 WP_002209950.1.23811 WP_002209950.1.24002 WP_002209950.1.2451 WP_002209950.1.25181 WP_002209950.1.25394 WP_002209950.1.26383 WP_002209950.1.2640 WP_002209950.1.26776 WP_002209950.1.26960 WP_002209950.1.27124 WP_002209950.1.27251 WP_002209950.1.2726 WP_002209950.1.28647 WP_002209950.1.28922 WP_002209950.1.29157 WP_002209950.1.29355 WP_002209950.1.2947 WP_002209950.1.29622 WP_002209950.1.2964 WP_002209950.1.29685 WP_002209950.1.29814 WP_002209950.1.3092 WP_002209950.1.30931 WP_002209950.1.311 WP_002209950.1.31336 WP_002209950.1.31496 WP_002209950.1.31739 WP_002209950.1.31805 WP_002209950.1.32343 WP_002209950.1.32388 WP_002209950.1.32446 WP_002209950.1.33661 WP_002209950.1.33937 WP_002209950.1.34031 WP_002209950.1.34138 WP_002209950.1.35389 WP_002209950.1.35538 WP_002209950.1.36088 WP_002209950.1.37174 WP_002209950.1.37494 WP_002209950.1.37863 WP_002209950.1.38147 WP_002209950.1.38235 WP_002209950.1.38532 WP_002209950.1.38743 WP_002209950.1.38824 WP_002209950.1.38993 WP_002209950.1.39066 WP_002209950.1.39346 WP_002209950.1.3976 WP_002209950.1.40071 WP_002209950.1.40134 WP_002209950.1.40534 WP_002209950.1.40853 WP_002209950.1.41196 WP_002209950.1.4210 WP_002209950.1.42490 WP_002209950.1.44408 WP_002209950.1.44598 WP_002209950.1.44603 WP_002209950.1.44832 WP_002209950.1.45198 WP_002209950.1.45214 WP_002209950.1.46262 WP_002209950.1.46545 WP_002209950.1.46686 WP_002209950.1.46731 WP_002209950.1.4678 WP_002209950.1.46891 WP_002209950.1.47387 WP_002209950.1.47440 WP_002209950.1.47769 WP_002209950.1.48166 WP_002209950.1.48722 WP_002209950.1.4889 WP_002209950.1.49906 WP_002209950.1.4997 WP_002209950.1.50010 WP_002209950.1.50093 WP_002209950.1.50106 WP_002209950.1.50185 WP_002209950.1.50984 WP_002209950.1.51293 WP_002209950.1.51588 WP_002209950.1.51772 WP_002209950.1.51934 WP_002209950.1.52158 WP_002209950.1.52247 WP_002209950.1.52569 WP_002209950.1.52734 WP_002209950.1.52792 WP_002209950.1.52819 WP_002209950.1.52969 WP_002209950.1.53300 WP_002209950.1.53838 WP_002209950.1.53848 WP_002209950.1.53953 WP_002209950.1.54568 WP_002209950.1.54951 WP_002209950.1.55194 WP_002209950.1.55695 WP_002209950.1.5592 WP_002209950.1.56031 WP_002209950.1.56912 WP_002209950.1.56953 WP_002209950.1.57585 WP_002209950.1.57657 WP_002209950.1.58067 WP_002209950.1.58794 WP_002209950.1.59102 WP_002209950.1.59431 WP_002209950.1.5957 WP_002209950.1.59635 WP_002209950.1.59687 WP_002209950.1.59789 WP_002209950.1.59885 WP_002209950.1.60437 WP_002209950.1.60707 WP_002209950.1.60896 WP_002209950.1.61689 WP_002209950.1.62232 WP_002209950.1.62342 WP_002209950.1.6270 WP_002209950.1.6333 WP_002209950.1.63387 WP_002209950.1.63517 WP_002209950.1.64142 WP_002209950.1.64474 WP_002209950.1.64780 WP_002209950.1.64786 WP_002209950.1.64910 WP_002209950.1.653 WP_002209950.1.65400 WP_002209950.1.65554 WP_002209950.1.6570 WP_002209950.1.65706 WP_002209950.1.65718 WP_002209950.1.6581 WP_002209950.1.66118 WP_002209950.1.66546 WP_002209950.1.66616 WP_002209950.1.67404 WP_002209950.1.67850 WP_002209950.1.68361 WP_002209950.1.68371 WP_002209950.1.68753 WP_002209950.1.68855 WP_002209950.1.69018 WP_002209950.1.69316 WP_002209950.1.69951 WP_002209950.1.70117 WP_002209950.1.70171 WP_002209950.1.70319 WP_002209950.1.70377 WP_002209950.1.70417 WP_002209950.1.70726 WP_002209950.1.7083 WP_002209950.1.7169 WP_002209950.1.71744 WP_002209950.1.72280 WP_002209950.1.72440 WP_002209950.1.72486 WP_002209950.1.7402 WP_002209950.1.74131 WP_002209950.1.74310 WP_002209950.1.74577 WP_002209950.1.74738 WP_002209950.1.75173 WP_002209950.1.7518 WP_002209950.1.75337 WP_002209950.1.75407 WP_002209950.1.75636 WP_002209950.1.75821 WP_002209950.1.76555 WP_002209950.1.76670 WP_002209950.1.77387 WP_002209950.1.77429 WP_002209950.1.77691 WP_002209950.1.78004 WP_002209950.1.7841 WP_002209950.1.78556 WP_002209950.1.79515 WP_002209950.1.79550 WP_002209950.1.79609 WP_002209950.1.79981 WP_002209950.1.8009 WP_002209950.1.80331 WP_002209950.1.81848 WP_002209950.1.81877 WP_002209950.1.8210 WP_002209950.1.82133 WP_002209950.1.82270 WP_002209950.1.82436 WP_002209950.1.82619 WP_002209950.1.8303 WP_002209950.1.83039 WP_002209950.1.83265 WP_002209950.1.8420 WP_002209950.1.84703 WP_002209950.1.84720 WP_002209950.1.85269 WP_002209950.1.85270 WP_002209950.1.8559 WP_002209950.1.85802 WP_002209950.1.86034 WP_002209950.1.86413 WP_002209950.1.87107 WP_002209950.1.8728 WP_002209950.1.87418 WP_002209950.1.8762 WP_002209950.1.87853 WP_002209950.1.87988 WP_002209950.1.88362 WP_002209950.1.88472 WP_002209950.1.89359 WP_002209950.1.8964 WP_002209950.1.90176 WP_002209950.1.9051 WP_002209950.1.90624 WP_002209950.1.91373 WP_002209950.1.91844 WP_002209950.1.92030 WP_002209950.1.92331 WP_002209950.1.92604 WP_002209950.1.927 WP_002209950.1.9311 WP_002209950.1.9320 WP_002209950.1.93623 WP_002209950.1.93928 WP_002209950.1.93933 WP_002209950.1.94052 WP_002209950.1.94201 WP_002209950.1.94545 WP_002209950.1.94683 WP_002209950.1.95746 WP_002209950.1.95981 WP_002209950.1.97245 WP_002209950.1.97375 WP_002209950.1.97448 WP_002209950.1.97791 WP_002209950.1.97864 WP_002209950.1.97872 WP_002209950.1.97894 WP_002209950.1.99109 WP_002209950.1.99383 WP_002209950.1.9941 WP_002209950.1.99416 WP_002209950.1.99788 WP_002209950.1.99882 YP_002345956.1.25044 gi|384121365|ref|YP_005503985.1| gi|218928081|ref|YP_002345956.1| gi|162139429|ref|YP_649034.2| gi|162100184|ref|YP_650272.2| gi|384125237|ref|YP_005507851.1| gi|384413509|ref|YP_005622871.1| gi|384137099|ref|YP_005519801.1| gi|162421882|ref|YP_001608138.1| gi|161484761|ref|NP_670594.2| gi|51597493|ref|YP_071684.1| gi|294502926|ref|YP_003566988.1| 187410.y3295 214092.YPO0908 229193.YP_3605 273123.YPTB3183 349746.YpAngola_A3829 360102.YPA_0359 377628.YPN_3107 IDP00443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]