SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384125577|ref|YP_005508191.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384125577|ref|YP_005508191.1|
Domain Number 1 Region: 1-293,476-535
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.62e-91
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 295-477
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.81e-62
Family GMC oxidoreductases 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384125577|ref|YP_005508191.1|
Sequence length 567
Comment choline dehydrogenase [Yersinia pestis D182038]
Sequence
MEYDYIIIGAGSAGNVLAARLTEDADVTVLLLEAGGPDYRLDFRTQMPAALAFPLQGKRY
NWAYETDPEPHMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDFDHWASLSGLEDWSYLD
CLPYFRKAETRDIGPNDFHGGEGPVSVTTPKIGNNPLFHAMVAAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPKGRRASTARGYLDQARPRNNLTIITHALTDRILFEGKRATGVRYLKG
DAGTGQTAYARREVLLCGGAIASPQILQRSGIGPAELLQRLDIPLVQALPGVGENLQDHL
EMYLQYSCKQPVSLYPALLWFNQPKIGIEWLFNGTGVGASNQFEAGGFIRSRDAFTWPNI
QYHFLPVAINYNGSNAVKEHGFQAHVGSMRSPSRGRIQVKSKDPRQHPSILFNYMSSEQD
WHEFRDAIRITREIIAQPALDPYRGREISPGANVQNDDELDAFIREHAETAYHPSCSCKM
GDDKMAVVDGQGRVHGVQGLRVVDASIMPQIITGNLNATTIMIAEKIADRIRGCQPLAKS
NAAYFIAGDTPARTSPVRHSLPVTSYP
Download sequence
Identical sequences A0A0E1NS57 A0A208RNW7 Q1C932 Q1CFR7 Q8ZGW0
214092.YPO1165 229193.YP_0994 360102.YPA_1073 377628.YPN_2836 gi|384125577|ref|YP_005508191.1| gi|384121606|ref|YP_005504226.1| gi|45440829|ref|NP_992368.1| WP_002220180.1.100083 WP_002220180.1.100921 WP_002220180.1.100931 WP_002220180.1.10105 WP_002220180.1.101305 WP_002220180.1.101928 WP_002220180.1.102012 WP_002220180.1.102067 WP_002220180.1.10736 WP_002220180.1.10935 WP_002220180.1.10955 WP_002220180.1.11693 WP_002220180.1.12463 WP_002220180.1.12736 WP_002220180.1.12857 WP_002220180.1.14063 WP_002220180.1.14804 WP_002220180.1.15321 WP_002220180.1.15555 WP_002220180.1.15605 WP_002220180.1.15689 WP_002220180.1.17141 WP_002220180.1.17873 WP_002220180.1.17983 WP_002220180.1.18208 WP_002220180.1.18640 WP_002220180.1.19329 WP_002220180.1.19739 WP_002220180.1.19763 WP_002220180.1.20035 WP_002220180.1.2064 WP_002220180.1.21486 WP_002220180.1.21784 WP_002220180.1.21879 WP_002220180.1.21934 WP_002220180.1.22530 WP_002220180.1.22542 WP_002220180.1.22708 WP_002220180.1.23271 WP_002220180.1.23811 WP_002220180.1.24002 WP_002220180.1.25394 WP_002220180.1.2640 WP_002220180.1.26776 WP_002220180.1.26960 WP_002220180.1.27251 WP_002220180.1.2726 WP_002220180.1.28647 WP_002220180.1.28922 WP_002220180.1.29157 WP_002220180.1.29355 WP_002220180.1.2947 WP_002220180.1.2964 WP_002220180.1.30931 WP_002220180.1.311 WP_002220180.1.31336 WP_002220180.1.31496 WP_002220180.1.31805 WP_002220180.1.32343 WP_002220180.1.32388 WP_002220180.1.32446 WP_002220180.1.33937 WP_002220180.1.34031 WP_002220180.1.34138 WP_002220180.1.35389 WP_002220180.1.35538 WP_002220180.1.36088 WP_002220180.1.37863 WP_002220180.1.38147 WP_002220180.1.38235 WP_002220180.1.38743 WP_002220180.1.39066 WP_002220180.1.39346 WP_002220180.1.40071 WP_002220180.1.40134 WP_002220180.1.40534 WP_002220180.1.41196 WP_002220180.1.42490 WP_002220180.1.44603 WP_002220180.1.44832 WP_002220180.1.45198 WP_002220180.1.46262 WP_002220180.1.46545 WP_002220180.1.46686 WP_002220180.1.46891 WP_002220180.1.47387 WP_002220180.1.47440 WP_002220180.1.48166 WP_002220180.1.48722 WP_002220180.1.4889 WP_002220180.1.49906 WP_002220180.1.4997 WP_002220180.1.50010 WP_002220180.1.50093 WP_002220180.1.50106 WP_002220180.1.50984 WP_002220180.1.51293 WP_002220180.1.51588 WP_002220180.1.51772 WP_002220180.1.51934 WP_002220180.1.52158 WP_002220180.1.52247 WP_002220180.1.52734 WP_002220180.1.52819 WP_002220180.1.53838 WP_002220180.1.53848 WP_002220180.1.53953 WP_002220180.1.54568 WP_002220180.1.54951 WP_002220180.1.55194 WP_002220180.1.55695 WP_002220180.1.5592 WP_002220180.1.56031 WP_002220180.1.56953 WP_002220180.1.57585 WP_002220180.1.57657 WP_002220180.1.58067 WP_002220180.1.59102 WP_002220180.1.59431 WP_002220180.1.5957 WP_002220180.1.59635 WP_002220180.1.59687 WP_002220180.1.59885 WP_002220180.1.60437 WP_002220180.1.61689 WP_002220180.1.62232 WP_002220180.1.62342 WP_002220180.1.63387 WP_002220180.1.64142 WP_002220180.1.64474 WP_002220180.1.64780 WP_002220180.1.64910 WP_002220180.1.653 WP_002220180.1.65400 WP_002220180.1.65554 WP_002220180.1.6570 WP_002220180.1.65706 WP_002220180.1.65718 WP_002220180.1.6581 WP_002220180.1.66546 WP_002220180.1.66616 WP_002220180.1.67404 WP_002220180.1.67850 WP_002220180.1.68361 WP_002220180.1.68855 WP_002220180.1.69018 WP_002220180.1.69316 WP_002220180.1.69951 WP_002220180.1.70117 WP_002220180.1.70171 WP_002220180.1.70319 WP_002220180.1.70377 WP_002220180.1.70417 WP_002220180.1.70726 WP_002220180.1.7083 WP_002220180.1.7169 WP_002220180.1.71744 WP_002220180.1.72280 WP_002220180.1.72440 WP_002220180.1.7402 WP_002220180.1.74131 WP_002220180.1.74310 WP_002220180.1.74577 WP_002220180.1.74738 WP_002220180.1.75173 WP_002220180.1.7518 WP_002220180.1.75337 WP_002220180.1.75407 WP_002220180.1.75689 WP_002220180.1.75821 WP_002220180.1.76670 WP_002220180.1.77429 WP_002220180.1.78556 WP_002220180.1.79515 WP_002220180.1.79550 WP_002220180.1.79981 WP_002220180.1.80331 WP_002220180.1.81848 WP_002220180.1.81877 WP_002220180.1.82151 WP_002220180.1.82270 WP_002220180.1.82619 WP_002220180.1.8303 WP_002220180.1.83039 WP_002220180.1.83265 WP_002220180.1.83630 WP_002220180.1.8420 WP_002220180.1.84720 WP_002220180.1.85269 WP_002220180.1.8559 WP_002220180.1.86034 WP_002220180.1.86413 WP_002220180.1.87107 WP_002220180.1.8728 WP_002220180.1.87418 WP_002220180.1.87988 WP_002220180.1.88362 WP_002220180.1.89359 WP_002220180.1.89542 WP_002220180.1.8964 WP_002220180.1.90176 WP_002220180.1.9051 WP_002220180.1.91263 WP_002220180.1.91373 WP_002220180.1.91844 WP_002220180.1.927 WP_002220180.1.9320 WP_002220180.1.93928 WP_002220180.1.93933 WP_002220180.1.94052 WP_002220180.1.94201 WP_002220180.1.94545 WP_002220180.1.94683 WP_002220180.1.95981 WP_002220180.1.97245 WP_002220180.1.97375 WP_002220180.1.97448 WP_002220180.1.97791 WP_002220180.1.97872 WP_002220180.1.97894 WP_002220180.1.99109 WP_002220180.1.99383 WP_002220180.1.9941 WP_002220180.1.99416 WP_002220180.1.99788 WP_002220180.1.99990 YP_002346204.1.25044 gi|384140874|ref|YP_005523576.1| gi|218928329|ref|YP_002346204.1| gi|294503165|ref|YP_003567227.1| gi|108812996|ref|YP_648763.1| gi|108807069|ref|YP_650985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]