SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384126049|ref|YP_005508663.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126049|ref|YP_005508663.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000028
Family FAD/NAD-linked reductases, N-terminal and central domains 0.051
Further Details:      
 
Weak hits

Sequence:  gi|384126049|ref|YP_005508663.1|
Domain Number - Region: 215-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000918
Family FAD/NAD-linked reductases, N-terminal and central domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384126049|ref|YP_005508663.1|
Sequence length 432
Comment putative siderophore biosynthetic enzyme [Yersinia pestis D182038]
Sequence
MRPYDFIGIGIGPFNLGLACLTQPLNDVCCLFIDQKAGFDWHPGMMLESATLQTPFMSDL
VTLASPTHPLSFLNYIKQQGRIYSFYIRENFFLLRKEYNQYCQWAVEQLPNLRFNTQVDD
IHYDEDTALYRLYCSDTCSGSRHEFLCKKLVLGTGPSPHIPECCQPFIQQIVMSGQYLEH
KVALQKKRAITILGSGQSAAEIFYDLLCEIDRFDYQLNWLTRSPRFLPLEYTKLTLEMTS
PEYVDYFYHLPPEKRDELNLTHKPLYKGINGTLINDIFDLLYTKRLNGALNVNLYTNSEL
QKVSSSHDGKGLHLSVLQHEQNQLFTLETEGAVLATGYHYQPPTFIEGIRQHIRWDNKGR
YEVQRNYSIDRNNTIFVQNVELHTHGFVTPDLGMACYRNSCLIREITGTEYYPIEKNIAF
QQFSAPSLRRKE
Download sequence
Identical sequences A0A0E1NYE5 A0A0H2W3M6 A0A0H2YIQ6 A0A0M1V342 A0A0U1ERL7 A0A0U1QZB5 A0A208S3D8 A0A2A7VGA0 Q3V7Q3 Q3V8F6
gi|384140586|ref|YP_005523288.1| gi|384121952|ref|YP_005504572.1| gi|153949169|ref|YP_001401416.1| gi|384126049|ref|YP_005508663.1| gi|22126519|ref|NP_669942.1| gi|186894966|ref|YP_001872078.1| gi|108806821|ref|YP_650737.1| 187410.y2640 214092.YPO1530 229193.YP_1419 273123.YPTB1542 349746.YpAngola_A3189 349747.YpsIP31758_2447 360102.YPA_0824 377628.YPN_2450 386656.YPDSF_1446 502801.YPTS_1652 gi|108812611|ref|YP_648378.1| gi|162420473|ref|YP_001607545.1| gi|51595879|ref|YP_070070.1| gi|218928671|ref|YP_002346546.1| WP_002211878.1.100083 WP_002211878.1.100246 WP_002211878.1.100921 WP_002211878.1.10105 WP_002211878.1.101305 WP_002211878.1.101382 WP_002211878.1.101928 WP_002211878.1.102012 WP_002211878.1.102067 WP_002211878.1.10736 WP_002211878.1.10935 WP_002211878.1.10955 WP_002211878.1.11693 WP_002211878.1.12167 WP_002211878.1.12463 WP_002211878.1.12736 WP_002211878.1.12857 WP_002211878.1.1388 WP_002211878.1.14063 WP_002211878.1.14169 WP_002211878.1.14804 WP_002211878.1.15321 WP_002211878.1.15555 WP_002211878.1.15605 WP_002211878.1.15689 WP_002211878.1.16243 WP_002211878.1.16333 WP_002211878.1.17135 WP_002211878.1.17141 WP_002211878.1.17608 WP_002211878.1.17983 WP_002211878.1.18208 WP_002211878.1.18640 WP_002211878.1.18826 WP_002211878.1.19329 WP_002211878.1.19425 WP_002211878.1.19739 WP_002211878.1.19763 WP_002211878.1.20380 WP_002211878.1.20547 WP_002211878.1.2064 WP_002211878.1.20932 WP_002211878.1.21486 WP_002211878.1.21784 WP_002211878.1.21879 WP_002211878.1.21934 WP_002211878.1.22530 WP_002211878.1.22542 WP_002211878.1.23157 WP_002211878.1.23271 WP_002211878.1.23687 WP_002211878.1.23811 WP_002211878.1.24002 WP_002211878.1.2451 WP_002211878.1.25181 WP_002211878.1.25394 WP_002211878.1.26383 WP_002211878.1.2640 WP_002211878.1.26776 WP_002211878.1.26960 WP_002211878.1.27124 WP_002211878.1.27251 WP_002211878.1.2726 WP_002211878.1.28647 WP_002211878.1.28922 WP_002211878.1.29157 WP_002211878.1.29355 WP_002211878.1.2947 WP_002211878.1.29622 WP_002211878.1.2964 WP_002211878.1.29685 WP_002211878.1.29814 WP_002211878.1.3092 WP_002211878.1.30931 WP_002211878.1.311 WP_002211878.1.31336 WP_002211878.1.31496 WP_002211878.1.31739 WP_002211878.1.31805 WP_002211878.1.32343 WP_002211878.1.32388 WP_002211878.1.32446 WP_002211878.1.32736 WP_002211878.1.33203 WP_002211878.1.33324 WP_002211878.1.33661 WP_002211878.1.33937 WP_002211878.1.34031 WP_002211878.1.34138 WP_002211878.1.35389 WP_002211878.1.35538 WP_002211878.1.36088 WP_002211878.1.37174 WP_002211878.1.37494 WP_002211878.1.37863 WP_002211878.1.38235 WP_002211878.1.38824 WP_002211878.1.38993 WP_002211878.1.39066 WP_002211878.1.3976 WP_002211878.1.39858 WP_002211878.1.40071 WP_002211878.1.40134 WP_002211878.1.40534 WP_002211878.1.40853 WP_002211878.1.41196 WP_002211878.1.4210 WP_002211878.1.42361 WP_002211878.1.42490 WP_002211878.1.42976 WP_002211878.1.44408 WP_002211878.1.44598 WP_002211878.1.44832 WP_002211878.1.45198 WP_002211878.1.45214 WP_002211878.1.46262 WP_002211878.1.46545 WP_002211878.1.46686 WP_002211878.1.46697 WP_002211878.1.46731 WP_002211878.1.4678 WP_002211878.1.46891 WP_002211878.1.47387 WP_002211878.1.47440 WP_002211878.1.47769 WP_002211878.1.48166 WP_002211878.1.48722 WP_002211878.1.4889 WP_002211878.1.49315 WP_002211878.1.49906 WP_002211878.1.4997 WP_002211878.1.50010 WP_002211878.1.50093 WP_002211878.1.50185 WP_002211878.1.50984 WP_002211878.1.51284 WP_002211878.1.51293 WP_002211878.1.51588 WP_002211878.1.51772 WP_002211878.1.51934 WP_002211878.1.52158 WP_002211878.1.52247 WP_002211878.1.52734 WP_002211878.1.52819 WP_002211878.1.53300 WP_002211878.1.53838 WP_002211878.1.53848 WP_002211878.1.53883 WP_002211878.1.53953 WP_002211878.1.54568 WP_002211878.1.54951 WP_002211878.1.55194 WP_002211878.1.55695 WP_002211878.1.56031 WP_002211878.1.56912 WP_002211878.1.57585 WP_002211878.1.57657 WP_002211878.1.58067 WP_002211878.1.58543 WP_002211878.1.58794 WP_002211878.1.59102 WP_002211878.1.59431 WP_002211878.1.5957 WP_002211878.1.59635 WP_002211878.1.59687 WP_002211878.1.59789 WP_002211878.1.59885 WP_002211878.1.60437 WP_002211878.1.60707 WP_002211878.1.60896 WP_002211878.1.62232 WP_002211878.1.62342 WP_002211878.1.6270 WP_002211878.1.6333 WP_002211878.1.63387 WP_002211878.1.63641 WP_002211878.1.64142 WP_002211878.1.64474 WP_002211878.1.64780 WP_002211878.1.64786 WP_002211878.1.64910 WP_002211878.1.653 WP_002211878.1.65554 WP_002211878.1.6570 WP_002211878.1.65706 WP_002211878.1.65718 WP_002211878.1.6581 WP_002211878.1.66118 WP_002211878.1.66546 WP_002211878.1.66616 WP_002211878.1.67404 WP_002211878.1.67850 WP_002211878.1.6791 WP_002211878.1.68361 WP_002211878.1.68753 WP_002211878.1.68855 WP_002211878.1.69018 WP_002211878.1.69316 WP_002211878.1.69951 WP_002211878.1.70117 WP_002211878.1.70171 WP_002211878.1.70319 WP_002211878.1.70377 WP_002211878.1.70417 WP_002211878.1.70726 WP_002211878.1.7083 WP_002211878.1.7169 WP_002211878.1.71744 WP_002211878.1.72280 WP_002211878.1.72440 WP_002211878.1.72486 WP_002211878.1.7402 WP_002211878.1.74131 WP_002211878.1.74310 WP_002211878.1.74577 WP_002211878.1.74738 WP_002211878.1.7518 WP_002211878.1.75208 WP_002211878.1.75337 WP_002211878.1.75636 WP_002211878.1.75689 WP_002211878.1.75821 WP_002211878.1.76670 WP_002211878.1.77387 WP_002211878.1.77429 WP_002211878.1.77691 WP_002211878.1.78004 WP_002211878.1.7841 WP_002211878.1.78556 WP_002211878.1.79515 WP_002211878.1.79550 WP_002211878.1.79981 WP_002211878.1.8009 WP_002211878.1.80331 WP_002211878.1.81848 WP_002211878.1.81877 WP_002211878.1.8210 WP_002211878.1.82133 WP_002211878.1.82151 WP_002211878.1.82270 WP_002211878.1.82619 WP_002211878.1.8303 WP_002211878.1.83039 WP_002211878.1.83265 WP_002211878.1.83630 WP_002211878.1.8420 WP_002211878.1.84703 WP_002211878.1.84720 WP_002211878.1.85269 WP_002211878.1.85270 WP_002211878.1.8559 WP_002211878.1.85802 WP_002211878.1.86034 WP_002211878.1.86413 WP_002211878.1.87107 WP_002211878.1.8728 WP_002211878.1.87418 WP_002211878.1.8762 WP_002211878.1.87853 WP_002211878.1.87988 WP_002211878.1.88362 WP_002211878.1.88472 WP_002211878.1.89359 WP_002211878.1.8964 WP_002211878.1.90176 WP_002211878.1.90624 WP_002211878.1.91373 WP_002211878.1.91844 WP_002211878.1.92030 WP_002211878.1.92331 WP_002211878.1.92604 WP_002211878.1.927 WP_002211878.1.9311 WP_002211878.1.9320 WP_002211878.1.93623 WP_002211878.1.93928 WP_002211878.1.94052 WP_002211878.1.94201 WP_002211878.1.94545 WP_002211878.1.94683 WP_002211878.1.95746 WP_002211878.1.95981 WP_002211878.1.97245 WP_002211878.1.97375 WP_002211878.1.97448 WP_002211878.1.97791 WP_002211878.1.97864 WP_002211878.1.97894 WP_002211878.1.99109 WP_002211878.1.99383 WP_002211878.1.9941 WP_002211878.1.99416 WP_002211878.1.99788 WP_002211878.1.99990 YP_002346546.1.25044 gi|145598730|ref|YP_001162806.1| gi|45441244|ref|NP_992783.1| gi|294503505|ref|YP_003567567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]