SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384126123|ref|YP_005508737.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126123|ref|YP_005508737.1|
Domain Number 1 Region: 8-46,99-263,351-409
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-47
Family FAD-linked reductases, N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 261-351
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.96e-17
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384126123|ref|YP_005508737.1|
Sequence length 426
Comment D-amino acid dehydrogenase small subunit [Yersinia pestis D182038]
Sequence
MWWVSPSAWYLAKEGHDVTVIDRQDGPAQETSAGNAGQISPGYAAPWAAPGVPLKAIKWM
FQRHAPLAIRLDGSSLQLRWMWQMLRNCDTSHYMVNKSRMVRLAEYSRDCLKDLRAATGI
QYEGRQGGTLQLFRTEQQFDNAAKDIAVLDDAGVPYSLLTAEQLATVEPALAKVAHKLTG
GLRLPNDETGDCKLFTERLAKMAEQAGVKFIFNRSVDKLLVEGDQIAGVLCGDDIIKADA
YVVAFGAYSTALLAGLVSIPVYPLKGYSLTIPITDPASAPFSTVLDETYKIAITRFDDRI
RVGGMAEIVGFNTQLAPARRETLEMVVRDLYPHGGDISQAVFWSGLRPMTPDGTPIVGRT
PLKNLYLNTGHGTLGWTMACGSGQLLADIIQGRRPAIVADDLSVARYRAGFQPLNIAPLH
DIHPIR
Download sequence
Identical sequences gi|384126123|ref|YP_005508737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]