SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384126569|ref|YP_005509183.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126569|ref|YP_005509183.1|
Domain Number 1 Region: 1-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384126569|ref|YP_005509183.1|
Sequence length 434
Comment NADH dehydrogenase [Yersinia pestis D182038]
Sequence
MTTLKKKIVIIGGGAGGLELATSLGHKLGRSKKADIVLVDRNHSHLWKPLLHEVATGSLD
DGVDALSYLAHARNHYFNFQLGSLTGINRENKTISLAEICDEHGDVLVTQRELSYDILVM
ALGSVSNDFGTPGVKDNCIFLDNPHQAHRFHNEMLNLFLKYSAQPGEKGKVDIAIVGGGA
TGVELSAELHNAVKQLHSYGFEGLDNHALNVTLVEAGERILPALPPRISSAAHQELTKLG
VRVLTKTMVTSADENGLNTKEGEFIHADLMVWAAGIKAPDFMKDIAGLETNRINQLVVEP
TLQTTRDPNIFAIGDCASCPQPSGGFVPPRAQSAHQMASRCYSNILALLNGQSLKPYIYK
DHGSLVSLSKFSTVGSLMGNLMRGSMMVEGRVARVVYISLYRMHQVALHGYTKTGLMMLV
GGINRVIRPRLKLH
Download sequence
Identical sequences A0A0E1NN22 A0A0H2W6L6 A0A0H2YJC4 A0A0H3B213 A0A0M1V1J6 A0A0U1EVQ3 A0A0U1QUQ1 A0A208RLR0 A0A2A7VGJ0 Q669N7 Q7CJ13
gi|45442027|ref|NP_993566.1| gi|162421720|ref|YP_001607205.1| gi|108812174|ref|YP_647941.1| gi|51596769|ref|YP_070960.1| gi|384140494|ref|YP_005523196.1| gi|218928753|ref|YP_002346628.1| gi|384126569|ref|YP_005509183.1| gi|22125671|ref|NP_669094.1| gi|108807900|ref|YP_651816.1| gi|294504182|ref|YP_003568244.1| gi|153947224|ref|YP_001400571.1| gi|170023943|ref|YP_001720448.1| 187410.y1777 214092.YPO1617 229193.YP_2237 273123.YPTB2447 349746.YpAngola_A2820 349747.YpsIP31758_1594 360102.YPA_1905 377628.YPN_2012 386656.YPDSF_1830 502800.YPK_1702 502801.YPTS_2531 WP_002213097.1.100083 WP_002213097.1.100246 WP_002213097.1.100593 WP_002213097.1.10066 WP_002213097.1.100921 WP_002213097.1.100931 WP_002213097.1.10105 WP_002213097.1.101305 WP_002213097.1.101382 WP_002213097.1.101928 WP_002213097.1.102012 WP_002213097.1.102067 WP_002213097.1.10736 WP_002213097.1.10935 WP_002213097.1.10955 WP_002213097.1.11693 WP_002213097.1.12167 WP_002213097.1.12463 WP_002213097.1.12736 WP_002213097.1.12857 WP_002213097.1.1388 WP_002213097.1.14063 WP_002213097.1.14169 WP_002213097.1.14804 WP_002213097.1.15321 WP_002213097.1.15555 WP_002213097.1.15605 WP_002213097.1.15689 WP_002213097.1.16243 WP_002213097.1.17135 WP_002213097.1.17141 WP_002213097.1.17608 WP_002213097.1.17873 WP_002213097.1.17983 WP_002213097.1.18208 WP_002213097.1.18640 WP_002213097.1.18826 WP_002213097.1.19329 WP_002213097.1.19425 WP_002213097.1.19739 WP_002213097.1.19763 WP_002213097.1.20035 WP_002213097.1.20380 WP_002213097.1.20547 WP_002213097.1.2064 WP_002213097.1.20932 WP_002213097.1.21486 WP_002213097.1.21784 WP_002213097.1.21879 WP_002213097.1.21934 WP_002213097.1.22530 WP_002213097.1.22542 WP_002213097.1.23271 WP_002213097.1.23687 WP_002213097.1.23811 WP_002213097.1.24002 WP_002213097.1.2451 WP_002213097.1.24517 WP_002213097.1.25181 WP_002213097.1.25394 WP_002213097.1.26383 WP_002213097.1.2640 WP_002213097.1.26776 WP_002213097.1.26960 WP_002213097.1.27124 WP_002213097.1.27251 WP_002213097.1.2726 WP_002213097.1.28647 WP_002213097.1.28922 WP_002213097.1.29157 WP_002213097.1.29186 WP_002213097.1.29355 WP_002213097.1.2947 WP_002213097.1.29622 WP_002213097.1.2964 WP_002213097.1.29685 WP_002213097.1.29814 WP_002213097.1.3092 WP_002213097.1.30931 WP_002213097.1.311 WP_002213097.1.31336 WP_002213097.1.31496 WP_002213097.1.31721 WP_002213097.1.31739 WP_002213097.1.31805 WP_002213097.1.32343 WP_002213097.1.32388 WP_002213097.1.32446 WP_002213097.1.32736 WP_002213097.1.33203 WP_002213097.1.33324 WP_002213097.1.33661 WP_002213097.1.33775 WP_002213097.1.33937 WP_002213097.1.34031 WP_002213097.1.34138 WP_002213097.1.35389 WP_002213097.1.35538 WP_002213097.1.36088 WP_002213097.1.37174 WP_002213097.1.37494 WP_002213097.1.37863 WP_002213097.1.38147 WP_002213097.1.38235 WP_002213097.1.38532 WP_002213097.1.38743 WP_002213097.1.38824 WP_002213097.1.38993 WP_002213097.1.39066 WP_002213097.1.3976 WP_002213097.1.39858 WP_002213097.1.40071 WP_002213097.1.40134 WP_002213097.1.40534 WP_002213097.1.40853 WP_002213097.1.41196 WP_002213097.1.41984 WP_002213097.1.4210 WP_002213097.1.42361 WP_002213097.1.42490 WP_002213097.1.42976 WP_002213097.1.44408 WP_002213097.1.44598 WP_002213097.1.44832 WP_002213097.1.45198 WP_002213097.1.45214 WP_002213097.1.46262 WP_002213097.1.46545 WP_002213097.1.46686 WP_002213097.1.46697 WP_002213097.1.4678 WP_002213097.1.46891 WP_002213097.1.47387 WP_002213097.1.47440 WP_002213097.1.47769 WP_002213097.1.47881 WP_002213097.1.48166 WP_002213097.1.48722 WP_002213097.1.4889 WP_002213097.1.49315 WP_002213097.1.49906 WP_002213097.1.4997 WP_002213097.1.50010 WP_002213097.1.50093 WP_002213097.1.50106 WP_002213097.1.50185 WP_002213097.1.50984 WP_002213097.1.51284 WP_002213097.1.51293 WP_002213097.1.51588 WP_002213097.1.51772 WP_002213097.1.51934 WP_002213097.1.52158 WP_002213097.1.52473 WP_002213097.1.52734 WP_002213097.1.52792 WP_002213097.1.52819 WP_002213097.1.52969 WP_002213097.1.53147 WP_002213097.1.53300 WP_002213097.1.53838 WP_002213097.1.53848 WP_002213097.1.53883 WP_002213097.1.53953 WP_002213097.1.54568 WP_002213097.1.54951 WP_002213097.1.55194 WP_002213097.1.55695 WP_002213097.1.5592 WP_002213097.1.56031 WP_002213097.1.56912 WP_002213097.1.56953 WP_002213097.1.57585 WP_002213097.1.57657 WP_002213097.1.58067 WP_002213097.1.58543 WP_002213097.1.58794 WP_002213097.1.59102 WP_002213097.1.59431 WP_002213097.1.5957 WP_002213097.1.59635 WP_002213097.1.5968 WP_002213097.1.59687 WP_002213097.1.59885 WP_002213097.1.60437 WP_002213097.1.60707 WP_002213097.1.60896 WP_002213097.1.61689 WP_002213097.1.62232 WP_002213097.1.62342 WP_002213097.1.6270 WP_002213097.1.6333 WP_002213097.1.63387 WP_002213097.1.63641 WP_002213097.1.64142 WP_002213097.1.64474 WP_002213097.1.64780 WP_002213097.1.64786 WP_002213097.1.64910 WP_002213097.1.653 WP_002213097.1.65400 WP_002213097.1.65554 WP_002213097.1.6570 WP_002213097.1.65706 WP_002213097.1.65718 WP_002213097.1.6581 WP_002213097.1.66546 WP_002213097.1.66616 WP_002213097.1.67404 WP_002213097.1.67850 WP_002213097.1.6791 WP_002213097.1.68361 WP_002213097.1.68371 WP_002213097.1.68753 WP_002213097.1.68855 WP_002213097.1.69018 WP_002213097.1.69316 WP_002213097.1.69951 WP_002213097.1.70117 WP_002213097.1.70171 WP_002213097.1.70319 WP_002213097.1.70377 WP_002213097.1.70417 WP_002213097.1.70726 WP_002213097.1.7083 WP_002213097.1.7169 WP_002213097.1.71744 WP_002213097.1.72280 WP_002213097.1.72440 WP_002213097.1.72486 WP_002213097.1.7402 WP_002213097.1.74131 WP_002213097.1.74310 WP_002213097.1.74577 WP_002213097.1.74738 WP_002213097.1.75169 WP_002213097.1.75173 WP_002213097.1.7518 WP_002213097.1.75208 WP_002213097.1.75337 WP_002213097.1.75407 WP_002213097.1.75636 WP_002213097.1.75689 WP_002213097.1.75821 WP_002213097.1.76555 WP_002213097.1.76670 WP_002213097.1.77295 WP_002213097.1.77387 WP_002213097.1.77429 WP_002213097.1.77569 WP_002213097.1.77691 WP_002213097.1.78004 WP_002213097.1.7841 WP_002213097.1.78556 WP_002213097.1.79515 WP_002213097.1.79550 WP_002213097.1.79825 WP_002213097.1.79981 WP_002213097.1.8009 WP_002213097.1.80331 WP_002213097.1.81848 WP_002213097.1.81877 WP_002213097.1.8210 WP_002213097.1.82133 WP_002213097.1.82151 WP_002213097.1.82270 WP_002213097.1.82436 WP_002213097.1.8303 WP_002213097.1.83039 WP_002213097.1.83265 WP_002213097.1.83630 WP_002213097.1.8420 WP_002213097.1.84720 WP_002213097.1.85269 WP_002213097.1.85270 WP_002213097.1.8559 WP_002213097.1.86034 WP_002213097.1.86059 WP_002213097.1.86413 WP_002213097.1.87107 WP_002213097.1.8728 WP_002213097.1.87418 WP_002213097.1.8762 WP_002213097.1.87853 WP_002213097.1.87988 WP_002213097.1.88362 WP_002213097.1.88472 WP_002213097.1.89359 WP_002213097.1.89542 WP_002213097.1.8964 WP_002213097.1.90176 WP_002213097.1.9051 WP_002213097.1.90624 WP_002213097.1.91373 WP_002213097.1.91844 WP_002213097.1.92030 WP_002213097.1.92331 WP_002213097.1.92604 WP_002213097.1.927 WP_002213097.1.9311 WP_002213097.1.9320 WP_002213097.1.93623 WP_002213097.1.93928 WP_002213097.1.94052 WP_002213097.1.94201 WP_002213097.1.94683 WP_002213097.1.95746 WP_002213097.1.95981 WP_002213097.1.97245 WP_002213097.1.97375 WP_002213097.1.97448 WP_002213097.1.97791 WP_002213097.1.97864 WP_002213097.1.97872 WP_002213097.1.97894 WP_002213097.1.99109 WP_002213097.1.99383 WP_002213097.1.9941 WP_002213097.1.99416 WP_002213097.1.99788 WP_002213097.1.99882 WP_002213097.1.99972 WP_002213097.1.99990 YP_002346628.1.25044 gi|384122703|ref|YP_005505323.1| gi|186895837|ref|YP_001872949.1| gi|145599112|ref|YP_001163188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]