SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384126699|ref|YP_005509313.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126699|ref|YP_005509313.1|
Domain Number 1 Region: 2-216,313-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.56e-45
Family FAD-linked reductases, N-terminal domain 0.00000764
Further Details:      
 
Domain Number 2 Region: 212-313
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.63e-20
Family D-aminoacid oxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384126699|ref|YP_005509313.1|
Sequence length 371
Comment putative sarcosine oxidase [Yersinia pestis D182038]
Sequence
MDYDLIVIGSGSVGSAAGYYASQAGLNVLMIDSAMPPHQAGSHHGETRIMRHAYGEGEKY
VPLVLRAQALWDQLAAQTGEKLFQACGVINLGPDNSTFLQNVQRSAQQYDLPVETLNSTQ
IREKWPVFTVPDNYIAVFEPQSGYLRSELAVKTLIKAVTEAGCGILFNCPVTAIESHQAG
VDVVTIDGTYSATKVVVTAGTWVKELLPTLPVTPVRKVFSWHQADGRYSEANHFPAFTVE
MPDNILYYGFPAQNDALKLGKHHGGQLIESAAQRKPFGRYAEDGTEVFSFLRHFLPGVGV
CLRGEACSYDMSPDEDFIIDTLPEDERVMVVSGLSGHGFKFATALGEVAALFAQDKPSPI
DISAFSLARFR
Download sequence
Identical sequences A0A0E1NY81 A0A0M1V3C6 A0A0U1EVE5 A0A151PPE5 A0A208S8Q9 A0A2A7VH03 A4TLT6 A7FH13 A9R633 B1JHH1 B2K770 P58526 Q1C6L1 Q1CI06 Q669J9
gi|145599145|ref|YP_001163221.1| gi|384414220|ref|YP_005623582.1| gi|384122732|ref|YP_005505352.1| gi|384139727|ref|YP_005522429.1| gi|218929537|ref|YP_002347412.1| gi|108807940|ref|YP_651856.1| gi|45442058|ref|NP_993597.1| gi|186895878|ref|YP_001872990.1| WP_002211850.1.100083 WP_002211850.1.100246 WP_002211850.1.10066 WP_002211850.1.100921 WP_002211850.1.100931 WP_002211850.1.10105 WP_002211850.1.101305 WP_002211850.1.101928 WP_002211850.1.10736 WP_002211850.1.10935 WP_002211850.1.10955 WP_002211850.1.11693 WP_002211850.1.12167 WP_002211850.1.12463 WP_002211850.1.12736 WP_002211850.1.12857 WP_002211850.1.1388 WP_002211850.1.14063 WP_002211850.1.14169 WP_002211850.1.14804 WP_002211850.1.15321 WP_002211850.1.15555 WP_002211850.1.15605 WP_002211850.1.15689 WP_002211850.1.16243 WP_002211850.1.16333 WP_002211850.1.17135 WP_002211850.1.17141 WP_002211850.1.17608 WP_002211850.1.17873 WP_002211850.1.17983 WP_002211850.1.18208 WP_002211850.1.18640 WP_002211850.1.19329 WP_002211850.1.19425 WP_002211850.1.19763 WP_002211850.1.20035 WP_002211850.1.20380 WP_002211850.1.20547 WP_002211850.1.20932 WP_002211850.1.21486 WP_002211850.1.21784 WP_002211850.1.21879 WP_002211850.1.21934 WP_002211850.1.22530 WP_002211850.1.22542 WP_002211850.1.22708 WP_002211850.1.23157 WP_002211850.1.23271 WP_002211850.1.23687 WP_002211850.1.23811 WP_002211850.1.24002 WP_002211850.1.2451 WP_002211850.1.24517 WP_002211850.1.25181 WP_002211850.1.25394 WP_002211850.1.26383 WP_002211850.1.2640 WP_002211850.1.26776 WP_002211850.1.26960 WP_002211850.1.27124 WP_002211850.1.27251 WP_002211850.1.2726 WP_002211850.1.28647 WP_002211850.1.28922 WP_002211850.1.29157 WP_002211850.1.29355 WP_002211850.1.2947 WP_002211850.1.29622 WP_002211850.1.2964 WP_002211850.1.29685 WP_002211850.1.29814 WP_002211850.1.3092 WP_002211850.1.30931 WP_002211850.1.311 WP_002211850.1.31336 WP_002211850.1.31496 WP_002211850.1.32343 WP_002211850.1.32388 WP_002211850.1.32446 WP_002211850.1.32736 WP_002211850.1.33324 WP_002211850.1.33661 WP_002211850.1.33937 WP_002211850.1.34031 WP_002211850.1.34138 WP_002211850.1.35389 WP_002211850.1.35538 WP_002211850.1.36088 WP_002211850.1.37174 WP_002211850.1.37494 WP_002211850.1.37863 WP_002211850.1.38147 WP_002211850.1.38235 WP_002211850.1.38532 WP_002211850.1.38824 WP_002211850.1.38993 WP_002211850.1.39066 WP_002211850.1.39346 WP_002211850.1.3976 WP_002211850.1.39858 WP_002211850.1.40134 WP_002211850.1.40534 WP_002211850.1.41196 WP_002211850.1.41984 WP_002211850.1.4210 WP_002211850.1.42361 WP_002211850.1.42490 WP_002211850.1.44408 WP_002211850.1.44598 WP_002211850.1.44603 WP_002211850.1.44832 WP_002211850.1.45198 WP_002211850.1.45214 WP_002211850.1.46262 WP_002211850.1.46545 WP_002211850.1.46697 WP_002211850.1.46731 WP_002211850.1.47387 WP_002211850.1.47440 WP_002211850.1.47769 WP_002211850.1.47881 WP_002211850.1.48166 WP_002211850.1.48722 WP_002211850.1.49315 WP_002211850.1.49906 WP_002211850.1.4997 WP_002211850.1.50010 WP_002211850.1.50093 WP_002211850.1.50185 WP_002211850.1.50984 WP_002211850.1.51293 WP_002211850.1.51588 WP_002211850.1.51772 WP_002211850.1.51934 WP_002211850.1.52158 WP_002211850.1.52473 WP_002211850.1.52734 WP_002211850.1.52792 WP_002211850.1.52819 WP_002211850.1.52969 WP_002211850.1.53147 WP_002211850.1.53300 WP_002211850.1.53838 WP_002211850.1.53883 WP_002211850.1.53953 WP_002211850.1.54568 WP_002211850.1.54951 WP_002211850.1.55194 WP_002211850.1.55695 WP_002211850.1.5592 WP_002211850.1.56031 WP_002211850.1.57657 WP_002211850.1.58067 WP_002211850.1.58543 WP_002211850.1.58794 WP_002211850.1.59102 WP_002211850.1.59431 WP_002211850.1.5957 WP_002211850.1.59635 WP_002211850.1.59687 WP_002211850.1.59885 WP_002211850.1.60437 WP_002211850.1.60707 WP_002211850.1.60896 WP_002211850.1.61689 WP_002211850.1.62232 WP_002211850.1.62342 WP_002211850.1.6270 WP_002211850.1.6333 WP_002211850.1.63641 WP_002211850.1.64142 WP_002211850.1.64474 WP_002211850.1.64780 WP_002211850.1.64786 WP_002211850.1.64910 WP_002211850.1.653 WP_002211850.1.65400 WP_002211850.1.6570 WP_002211850.1.65706 WP_002211850.1.65718 WP_002211850.1.6581 WP_002211850.1.66118 WP_002211850.1.66616 WP_002211850.1.67850 WP_002211850.1.6791 WP_002211850.1.68361 WP_002211850.1.68371 WP_002211850.1.68753 WP_002211850.1.68855 WP_002211850.1.69018 WP_002211850.1.69316 WP_002211850.1.69951 WP_002211850.1.70117 WP_002211850.1.70171 WP_002211850.1.70319 WP_002211850.1.70377 WP_002211850.1.70417 WP_002211850.1.70726 WP_002211850.1.7083 WP_002211850.1.7169 WP_002211850.1.71744 WP_002211850.1.72280 WP_002211850.1.72440 WP_002211850.1.72486 WP_002211850.1.7402 WP_002211850.1.74131 WP_002211850.1.74310 WP_002211850.1.74738 WP_002211850.1.75173 WP_002211850.1.7518 WP_002211850.1.75208 WP_002211850.1.75337 WP_002211850.1.75636 WP_002211850.1.76555 WP_002211850.1.76670 WP_002211850.1.77387 WP_002211850.1.77429 WP_002211850.1.77691 WP_002211850.1.78004 WP_002211850.1.7841 WP_002211850.1.78556 WP_002211850.1.79515 WP_002211850.1.79550 WP_002211850.1.79609 WP_002211850.1.79981 WP_002211850.1.8009 WP_002211850.1.80331 WP_002211850.1.81848 WP_002211850.1.81877 WP_002211850.1.82133 WP_002211850.1.82151 WP_002211850.1.82270 WP_002211850.1.82436 WP_002211850.1.82619 WP_002211850.1.8303 WP_002211850.1.83039 WP_002211850.1.83265 WP_002211850.1.8420 WP_002211850.1.84703 WP_002211850.1.84720 WP_002211850.1.8559 WP_002211850.1.86034 WP_002211850.1.86059 WP_002211850.1.86413 WP_002211850.1.87107 WP_002211850.1.8728 WP_002211850.1.87418 WP_002211850.1.8762 WP_002211850.1.87988 WP_002211850.1.88362 WP_002211850.1.89359 WP_002211850.1.89542 WP_002211850.1.8964 WP_002211850.1.90176 WP_002211850.1.9051 WP_002211850.1.90624 WP_002211850.1.91373 WP_002211850.1.92030 WP_002211850.1.927 WP_002211850.1.9311 WP_002211850.1.9320 WP_002211850.1.93623 WP_002211850.1.93928 WP_002211850.1.93933 WP_002211850.1.94052 WP_002211850.1.94201 WP_002211850.1.94545 WP_002211850.1.94683 WP_002211850.1.95746 WP_002211850.1.95981 WP_002211850.1.97245 WP_002211850.1.97375 WP_002211850.1.97448 WP_002211850.1.97791 WP_002211850.1.97864 WP_002211850.1.97872 WP_002211850.1.97894 WP_002211850.1.99109 WP_002211850.1.99383 WP_002211850.1.99416 WP_002211850.1.99882 WP_002211850.1.99990 YP_002347412.1.25044 gi|153949711|ref|YP_001400541.1| gi|51596807|ref|YP_070998.1| gi|384126699|ref|YP_005509313.1| gi|162419590|ref|YP_001606201.1| 214092.YPO2448 229193.YP_2268 273123.YPTB2485 349746.YpAngola_A1706 349747.YpsIP31758_1564 360102.YPA_1945 377628.YPN_2045 386656.YPDSF_1863 502800.YPK_1672 502801.YPTS_2573 gi|170023913|ref|YP_001720418.1| gi|294504211|ref|YP_003568273.1| gi|108812207|ref|YP_647974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]