SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384126747|ref|YP_005509361.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126747|ref|YP_005509361.1|
Domain Number 1 Region: 7-180,269-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.28e-62
Family HI0933 N-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384126747|ref|YP_005509361.1|
Sequence length 393
Comment 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Yersinia pestis D182038]
Sequence
MNKSQPNYDVVVVGGGMVGAAAALGLAQIGWSVALLEHDAPAPFDKDSVPDLRVSALGCT
SVALLKQLGAWPQVQQMRYAPYRRLETWEQPGSQVVFDAASLSLPELGFMVENRILQLAL
WQQFAECPNLTLLCPSRLQSMVRIDDYWKVTLNEQEEIQGRLVIGADGANSLVRRLAGIG
TSGWQYRQSCMLITVETDVMQQDTTWQQFFPTGPRAFLPLFDHWASLVWYDSPQRIRQLQ
AMSMAQLSQEIAAFFPSRLGAVKAIAAGAFPLVRRHAQQYVKPGLVLLGDAAHTINPLAG
QGVNLGYRDVDALLEVLSQARELAEPWHSEQVLLRYQRRRRTDNLMMQSGMDLFYTAFSN
DLPAVKFARNLALMVAQRAGKLKEHALRYALGL
Download sequence
Identical sequences A0A0E1NVR1 A0A0H2W2X1 A0A0H2YFH9 A0A0H3B568 A0A0M1V8E9 A0A208S6Z5 Q7CJU6
WP_002210347.1.100083 WP_002210347.1.100246 WP_002210347.1.100921 WP_002210347.1.100931 WP_002210347.1.10105 WP_002210347.1.101305 WP_002210347.1.101382 WP_002210347.1.101928 WP_002210347.1.102012 WP_002210347.1.102067 WP_002210347.1.10736 WP_002210347.1.10955 WP_002210347.1.11693 WP_002210347.1.12463 WP_002210347.1.12736 WP_002210347.1.12857 WP_002210347.1.1388 WP_002210347.1.14063 WP_002210347.1.14804 WP_002210347.1.15321 WP_002210347.1.15555 WP_002210347.1.15605 WP_002210347.1.15689 WP_002210347.1.16243 WP_002210347.1.16333 WP_002210347.1.17135 WP_002210347.1.17141 WP_002210347.1.17608 WP_002210347.1.17873 WP_002210347.1.17983 WP_002210347.1.18208 WP_002210347.1.18640 WP_002210347.1.18826 WP_002210347.1.19329 WP_002210347.1.19425 WP_002210347.1.19739 WP_002210347.1.19763 WP_002210347.1.20035 WP_002210347.1.2064 WP_002210347.1.21486 WP_002210347.1.21784 WP_002210347.1.21879 WP_002210347.1.21934 WP_002210347.1.22530 WP_002210347.1.22542 WP_002210347.1.22708 WP_002210347.1.23271 WP_002210347.1.23687 WP_002210347.1.23811 WP_002210347.1.24002 WP_002210347.1.2451 WP_002210347.1.25181 WP_002210347.1.25394 WP_002210347.1.2640 WP_002210347.1.26776 WP_002210347.1.26960 WP_002210347.1.27124 WP_002210347.1.27251 WP_002210347.1.2726 WP_002210347.1.28647 WP_002210347.1.28922 WP_002210347.1.29157 WP_002210347.1.29355 WP_002210347.1.2947 WP_002210347.1.29622 WP_002210347.1.2964 WP_002210347.1.29685 WP_002210347.1.29814 WP_002210347.1.3092 WP_002210347.1.30931 WP_002210347.1.311 WP_002210347.1.31336 WP_002210347.1.31496 WP_002210347.1.31739 WP_002210347.1.31805 WP_002210347.1.32343 WP_002210347.1.32388 WP_002210347.1.32446 WP_002210347.1.33203 WP_002210347.1.33661 WP_002210347.1.33937 WP_002210347.1.34031 WP_002210347.1.34138 WP_002210347.1.35389 WP_002210347.1.35538 WP_002210347.1.36088 WP_002210347.1.37494 WP_002210347.1.37863 WP_002210347.1.38147 WP_002210347.1.38235 WP_002210347.1.38743 WP_002210347.1.38824 WP_002210347.1.39066 WP_002210347.1.39346 WP_002210347.1.3976 WP_002210347.1.40071 WP_002210347.1.40134 WP_002210347.1.40534 WP_002210347.1.40853 WP_002210347.1.41196 WP_002210347.1.4210 WP_002210347.1.42490 WP_002210347.1.44408 WP_002210347.1.44598 WP_002210347.1.44603 WP_002210347.1.44832 WP_002210347.1.45198 WP_002210347.1.45214 WP_002210347.1.46262 WP_002210347.1.46545 WP_002210347.1.46686 WP_002210347.1.46731 WP_002210347.1.4678 WP_002210347.1.46891 WP_002210347.1.47387 WP_002210347.1.47440 WP_002210347.1.48166 WP_002210347.1.48722 WP_002210347.1.4889 WP_002210347.1.49906 WP_002210347.1.4997 WP_002210347.1.50010 WP_002210347.1.50093 WP_002210347.1.50106 WP_002210347.1.50984 WP_002210347.1.51284 WP_002210347.1.51293 WP_002210347.1.51588 WP_002210347.1.51934 WP_002210347.1.52158 WP_002210347.1.52247 WP_002210347.1.52734 WP_002210347.1.52792 WP_002210347.1.52819 WP_002210347.1.52969 WP_002210347.1.53838 WP_002210347.1.53848 WP_002210347.1.53953 WP_002210347.1.54568 WP_002210347.1.54951 WP_002210347.1.55194 WP_002210347.1.55695 WP_002210347.1.5592 WP_002210347.1.56031 WP_002210347.1.56912 WP_002210347.1.56953 WP_002210347.1.57585 WP_002210347.1.57657 WP_002210347.1.58067 WP_002210347.1.58794 WP_002210347.1.59102 WP_002210347.1.59431 WP_002210347.1.5957 WP_002210347.1.59635 WP_002210347.1.59687 WP_002210347.1.59789 WP_002210347.1.59885 WP_002210347.1.60437 WP_002210347.1.60707 WP_002210347.1.60896 WP_002210347.1.61689 WP_002210347.1.62232 WP_002210347.1.62342 WP_002210347.1.6270 WP_002210347.1.63387 WP_002210347.1.64142 WP_002210347.1.64474 WP_002210347.1.64780 WP_002210347.1.64786 WP_002210347.1.64910 WP_002210347.1.653 WP_002210347.1.65400 WP_002210347.1.65554 WP_002210347.1.6570 WP_002210347.1.65706 WP_002210347.1.65718 WP_002210347.1.6581 WP_002210347.1.66546 WP_002210347.1.66616 WP_002210347.1.67404 WP_002210347.1.67850 WP_002210347.1.68361 WP_002210347.1.68753 WP_002210347.1.68855 WP_002210347.1.69018 WP_002210347.1.69316 WP_002210347.1.69951 WP_002210347.1.70117 WP_002210347.1.70171 WP_002210347.1.70319 WP_002210347.1.70377 WP_002210347.1.70726 WP_002210347.1.7083 WP_002210347.1.7169 WP_002210347.1.71744 WP_002210347.1.72280 WP_002210347.1.72440 WP_002210347.1.72486 WP_002210347.1.7402 WP_002210347.1.74131 WP_002210347.1.74310 WP_002210347.1.74577 WP_002210347.1.74738 WP_002210347.1.75173 WP_002210347.1.7518 WP_002210347.1.75337 WP_002210347.1.75407 WP_002210347.1.75636 WP_002210347.1.75689 WP_002210347.1.75821 WP_002210347.1.76670 WP_002210347.1.77387 WP_002210347.1.77429 WP_002210347.1.78004 WP_002210347.1.7841 WP_002210347.1.78556 WP_002210347.1.79515 WP_002210347.1.79550 WP_002210347.1.79609 WP_002210347.1.79981 WP_002210347.1.8009 WP_002210347.1.80331 WP_002210347.1.81848 WP_002210347.1.81877 WP_002210347.1.8210 WP_002210347.1.82133 WP_002210347.1.82151 WP_002210347.1.82270 WP_002210347.1.82619 WP_002210347.1.8303 WP_002210347.1.83039 WP_002210347.1.83265 WP_002210347.1.8420 WP_002210347.1.84703 WP_002210347.1.84720 WP_002210347.1.85269 WP_002210347.1.85270 WP_002210347.1.8559 WP_002210347.1.85802 WP_002210347.1.86034 WP_002210347.1.86413 WP_002210347.1.87107 WP_002210347.1.8728 WP_002210347.1.87418 WP_002210347.1.8762 WP_002210347.1.87853 WP_002210347.1.87988 WP_002210347.1.88362 WP_002210347.1.88472 WP_002210347.1.89359 WP_002210347.1.8964 WP_002210347.1.90176 WP_002210347.1.9051 WP_002210347.1.90624 WP_002210347.1.91373 WP_002210347.1.91844 WP_002210347.1.92030 WP_002210347.1.92331 WP_002210347.1.92604 WP_002210347.1.927 WP_002210347.1.9311 WP_002210347.1.9320 WP_002210347.1.93623 WP_002210347.1.93928 WP_002210347.1.93933 WP_002210347.1.94052 WP_002210347.1.94201 WP_002210347.1.94545 WP_002210347.1.94683 WP_002210347.1.95746 WP_002210347.1.95981 WP_002210347.1.97245 WP_002210347.1.97375 WP_002210347.1.97448 WP_002210347.1.97791 WP_002210347.1.97864 WP_002210347.1.97872 WP_002210347.1.97894 WP_002210347.1.99109 WP_002210347.1.99383 WP_002210347.1.9941 WP_002210347.1.99416 WP_002210347.1.99788 WP_002210347.1.99882 WP_002210347.1.99990 YP_002347577.1.25044 gi|108811271|ref|YP_647038.1| gi|384122989|ref|YP_005505609.1| gi|162421210|ref|YP_001606316.1| gi|22125099|ref|NP_668522.1| gi|170025225|ref|YP_001721730.1| gi|384415670|ref|YP_005625032.1| gi|218929702|ref|YP_002347577.1| gi|145599894|ref|YP_001163970.1| gi|294504425|ref|YP_003568487.1| gi|45440922|ref|NP_992461.1| gi|384139546|ref|YP_005522248.1| gi|108808469|ref|YP_652385.1| gi|384126747|ref|YP_005509361.1| 187410.y1196 214092.YPO2621 229193.YP_1092 349746.YpAngola_A1828 360102.YPA_2476 377628.YPN_1107 386656.YPDSF_2631 502800.YPK_3004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]