SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384126824|ref|YP_005509438.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384126824|ref|YP_005509438.1|
Domain Number 1 Region: 9-255,356-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.44e-73
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000133
Further Details:      
 
Domain Number 2 Region: 238-353
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.84e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000719
Further Details:      
 
Domain Number 3 Region: 425-525
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 6.8e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384126824|ref|YP_005509438.1|
Sequence length 533
Comment L-aspartate oxidase [Yersinia pestis D182038]
Sequence
MQSSSEHISDVLIIGSGAAGLSLALRLAPHCKVTVLSKGPLNEGATFYAQGGIAAVFDET
DSISSHVDDTLIAGAGLCDKEAVEFIASNARSCVQWLIDQGVLFDTETSANGEERYHLTR
EGGHSHRRILHTADATGKEVETTLVGKASNHPNISVKERCNAVDLITSNKIGLAGTKRVV
GAYVWNRELEKVETFRAKAVVLATGGAAKVYQYTTNPDISSGDGIAMAWRAGCRVANLEF
NQFHPTCLFHPQARNFLLTEALRGEGAYLKRPDGSRFMLDFDPRGELAPRDIVARAIDHE
MKRLGADCMYLDISHKPTDFVMQHFPMIYEKLLSLGIDLTKEAIPIVPAAHYTCGGVMVD
QHGRTDLDGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDILTRLPTAKLAKHLP
DWDESRVDNSDERVVIQHNWHELRLFMWDYVGIVRTTKRLERALRRINTLQQEIDEYYAN
FRISNNLLELRNLVQVAELIVRCAMERKESRGLHYTLDYPDQIENPQPTILHP
Download sequence
Identical sequences A0A0E1NXP5 A0A0M1VA52 A0A0U1QV01 Q8ZD80
349746.YpAngola_A3603 349747.YpsIP31758_1128 gi|294504501|ref|YP_003568563.1| gi|384126824|ref|YP_005509438.1| gi|384122911|ref|YP_005505531.1| gi|384415577|ref|YP_005624939.1| gi|384139450|ref|YP_005522152.1| gi|153947342|ref|YP_001400109.1| gi|162419916|ref|YP_001607927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]