SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127076|ref|YP_005509690.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127076|ref|YP_005509690.1|
Domain Number 1 Region: 2-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0022
Further Details:      
 
Domain Number 2 Region: 325-447
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.36e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 432-543
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.4e-26
Family Single-domain sulfurtransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384127076|ref|YP_005509690.1|
Sequence length 548
Comment putative pyridine nucleotide-disulfide oxidoreductase [Yersinia pestis D182038]
Sequence
MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERDKL
LIQTPEKMKDRFNIDVRTENEVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFI
PDIAGLSVNGPVFTLRNMSDTDNIKAYLISATPEAVTVIGGGFIGLEMAENLVSSGLKVT
IIELSNQILSPLDYEMAAIVEKHLKDNGIDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIP
LAWPANRQGRLLADIINGRDVRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVH
IHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGTDKRIDVLATAIKGRLTIYDL
PDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
ISGSIKTAVNIPLSELRQKLALIPQDKKILVTCQVGLRGYIAARILSQYGYTVANLDGGY
LTFNYANA
Download sequence
Identical sequences A0A0E1NRK3 A0A0H2YHQ9 A0A0M1VDE0 A0A0U1EUH7 A0A208S7K7 Q0WCR3 Q7CJG4
gi|384127076|ref|YP_005509690.1| gi|108808185|ref|YP_652101.1| gi|384413939|ref|YP_005623301.1| gi|162420649|ref|YP_001607149.1| gi|145599385|ref|YP_001163461.1| gi|186896124|ref|YP_001873236.1| gi|45442403|ref|NP_993942.1| WP_002208497.1.100083 WP_002208497.1.100246 WP_002208497.1.100921 WP_002208497.1.10105 WP_002208497.1.101305 WP_002208497.1.101382 WP_002208497.1.101928 WP_002208497.1.102012 WP_002208497.1.102067 WP_002208497.1.10736 WP_002208497.1.10935 WP_002208497.1.10955 WP_002208497.1.11693 WP_002208497.1.12463 WP_002208497.1.12857 WP_002208497.1.1388 WP_002208497.1.14063 WP_002208497.1.14804 WP_002208497.1.15321 WP_002208497.1.15555 WP_002208497.1.15605 WP_002208497.1.16243 WP_002208497.1.16333 WP_002208497.1.17135 WP_002208497.1.17141 WP_002208497.1.17608 WP_002208497.1.17873 WP_002208497.1.17983 WP_002208497.1.18208 WP_002208497.1.18640 WP_002208497.1.18826 WP_002208497.1.19329 WP_002208497.1.19425 WP_002208497.1.19739 WP_002208497.1.19763 WP_002208497.1.20380 WP_002208497.1.2064 WP_002208497.1.20932 WP_002208497.1.21486 WP_002208497.1.21784 WP_002208497.1.21879 WP_002208497.1.21934 WP_002208497.1.22542 WP_002208497.1.23157 WP_002208497.1.23271 WP_002208497.1.23687 WP_002208497.1.24002 WP_002208497.1.2451 WP_002208497.1.25181 WP_002208497.1.2640 WP_002208497.1.26960 WP_002208497.1.27124 WP_002208497.1.27251 WP_002208497.1.2726 WP_002208497.1.28647 WP_002208497.1.29157 WP_002208497.1.29355 WP_002208497.1.29622 WP_002208497.1.2964 WP_002208497.1.29685 WP_002208497.1.29814 WP_002208497.1.3092 WP_002208497.1.31336 WP_002208497.1.31496 WP_002208497.1.31739 WP_002208497.1.31805 WP_002208497.1.32343 WP_002208497.1.32446 WP_002208497.1.32736 WP_002208497.1.33203 WP_002208497.1.33324 WP_002208497.1.33661 WP_002208497.1.33937 WP_002208497.1.34031 WP_002208497.1.34138 WP_002208497.1.35389 WP_002208497.1.35538 WP_002208497.1.36088 WP_002208497.1.37174 WP_002208497.1.37494 WP_002208497.1.37863 WP_002208497.1.38235 WP_002208497.1.38824 WP_002208497.1.38993 WP_002208497.1.39066 WP_002208497.1.3976 WP_002208497.1.39858 WP_002208497.1.40071 WP_002208497.1.40134 WP_002208497.1.40853 WP_002208497.1.41196 WP_002208497.1.4210 WP_002208497.1.42490 WP_002208497.1.44408 WP_002208497.1.44832 WP_002208497.1.45198 WP_002208497.1.45214 WP_002208497.1.46262 WP_002208497.1.46545 WP_002208497.1.46686 WP_002208497.1.46697 WP_002208497.1.46731 WP_002208497.1.4678 WP_002208497.1.46891 WP_002208497.1.47387 WP_002208497.1.47440 WP_002208497.1.48722 WP_002208497.1.4997 WP_002208497.1.50010 WP_002208497.1.50093 WP_002208497.1.50984 WP_002208497.1.51284 WP_002208497.1.51293 WP_002208497.1.51588 WP_002208497.1.51772 WP_002208497.1.52158 WP_002208497.1.52247 WP_002208497.1.52473 WP_002208497.1.52734 WP_002208497.1.52819 WP_002208497.1.53838 WP_002208497.1.53848 WP_002208497.1.53953 WP_002208497.1.54568 WP_002208497.1.54951 WP_002208497.1.55194 WP_002208497.1.5592 WP_002208497.1.56031 WP_002208497.1.56912 WP_002208497.1.57585 WP_002208497.1.57657 WP_002208497.1.58067 WP_002208497.1.58794 WP_002208497.1.59102 WP_002208497.1.59431 WP_002208497.1.5957 WP_002208497.1.59635 WP_002208497.1.59789 WP_002208497.1.60437 WP_002208497.1.60707 WP_002208497.1.60896 WP_002208497.1.62232 WP_002208497.1.62342 WP_002208497.1.6270 WP_002208497.1.63387 WP_002208497.1.63641 WP_002208497.1.64142 WP_002208497.1.64474 WP_002208497.1.64780 WP_002208497.1.64786 WP_002208497.1.64910 WP_002208497.1.653 WP_002208497.1.65400 WP_002208497.1.65554 WP_002208497.1.6570 WP_002208497.1.65706 WP_002208497.1.65718 WP_002208497.1.6581 WP_002208497.1.66118 WP_002208497.1.66546 WP_002208497.1.66616 WP_002208497.1.67404 WP_002208497.1.67850 WP_002208497.1.68361 WP_002208497.1.68753 WP_002208497.1.68855 WP_002208497.1.69018 WP_002208497.1.69316 WP_002208497.1.70117 WP_002208497.1.70171 WP_002208497.1.70319 WP_002208497.1.70377 WP_002208497.1.70417 WP_002208497.1.70726 WP_002208497.1.7083 WP_002208497.1.7169 WP_002208497.1.71744 WP_002208497.1.72280 WP_002208497.1.72440 WP_002208497.1.72486 WP_002208497.1.7402 WP_002208497.1.74131 WP_002208497.1.74310 WP_002208497.1.74577 WP_002208497.1.74738 WP_002208497.1.7518 WP_002208497.1.75208 WP_002208497.1.75337 WP_002208497.1.75636 WP_002208497.1.77387 WP_002208497.1.77429 WP_002208497.1.77691 WP_002208497.1.78004 WP_002208497.1.7841 WP_002208497.1.78556 WP_002208497.1.79550 WP_002208497.1.79981 WP_002208497.1.8009 WP_002208497.1.80331 WP_002208497.1.81848 WP_002208497.1.81877 WP_002208497.1.8210 WP_002208497.1.82133 WP_002208497.1.82151 WP_002208497.1.82270 WP_002208497.1.82619 WP_002208497.1.8303 WP_002208497.1.83265 WP_002208497.1.83630 WP_002208497.1.8420 WP_002208497.1.84703 WP_002208497.1.84720 WP_002208497.1.85269 WP_002208497.1.85270 WP_002208497.1.8559 WP_002208497.1.85802 WP_002208497.1.86034 WP_002208497.1.87107 WP_002208497.1.8728 WP_002208497.1.87418 WP_002208497.1.8762 WP_002208497.1.87853 WP_002208497.1.87988 WP_002208497.1.88362 WP_002208497.1.89359 WP_002208497.1.8964 WP_002208497.1.90176 WP_002208497.1.90624 WP_002208497.1.91373 WP_002208497.1.91844 WP_002208497.1.92030 WP_002208497.1.92331 WP_002208497.1.92604 WP_002208497.1.927 WP_002208497.1.9311 WP_002208497.1.9320 WP_002208497.1.93623 WP_002208497.1.93928 WP_002208497.1.94052 WP_002208497.1.94201 WP_002208497.1.94545 WP_002208497.1.94683 WP_002208497.1.95746 WP_002208497.1.95981 WP_002208497.1.97245 WP_002208497.1.97375 WP_002208497.1.97448 WP_002208497.1.97791 WP_002208497.1.97894 WP_002208497.1.99109 WP_002208497.1.99383 WP_002208497.1.9941 WP_002208497.1.99990 YP_002347925.1.25044 IDP01665 gi|294504754|ref|YP_003568816.1| gi|218930050|ref|YP_002347925.1| gi|108811544|ref|YP_647311.1| gi|384139152|ref|YP_005521854.1| 187410.y1479 214092.YPO3001 229193.YP_2626 349746.YpAngola_A2756 360102.YPA_2191 377628.YPN_1381 386656.YPDSF_2109 502801.YPTS_2822 gi|22125376|ref|NP_668799.1| gi|384123220|ref|YP_005505840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]