SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127404|ref|YP_005510018.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127404|ref|YP_005510018.1|
Domain Number 1 Region: 150-344
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.66e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000118
Further Details:      
 
Domain Number 2 Region: 429-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000728
Further Details:      
 
Domain Number 3 Region: 13-142
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.27e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00011
Further Details:      
 
Domain Number 4 Region: 346-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.2e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384127404|ref|YP_005510018.1|
Sequence length 576
Comment sulfite reductase [NADPH] hemoprotein beta-component [Yersinia pestis D182038]
Sequence
MNEKHPGPLVVSGKLSDGERMKSESNFLRGTIAEDLNNGLTGGFSGDNFLLIRFHGMYQQ
DDRDIRAERAEQKLEPRHAMMLRCRLPGGIITPQQWLGIDKFAADNTLYGSIRITNRQTF
QFHGILKGNVKPAHQLLNELGLDALATANDVNRNVLCTSNPVESALHQEAYEWAKKISEH
LLPRTRAYAEIWLDAEKVATTDEEPILGATYLPRKFKTTVVIPPQNDVDLHANDLNFVAV
ADKGKLIGFNVLVGGGLSIAHGDKNTYPRKASEFGYIPLKHTLAIAEAVVTTQRDWGNRT
DRKNAKTKYTLERVGVETFKAEVEKRAGVSFSAIKPYQFIGRGDRIGWVKGVDKKWHLTL
FVENGRLLDYPGRSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGL
MDDNVTSQRENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGLADEHIVLRVTGC
PNGCGRALLAEVGLVGKAVGRYNLHLGGNREGTRIPRMYRENITADEILLITDQLVGRWA
KERHVDEGFGDFVIRAGVIAPVIDSARDFYDVQEAM
Download sequence
Identical sequences A0A0E1NPM2 A0A0M1VBA8 A0A151DF81 A0A208SAT0 A4TPY6 Q1C3Z1 Q1CLS7 Q8ZBN7
IDP00459 gi|384416063|ref|YP_005625425.1| gi|108810886|ref|YP_646653.1| gi|384123542|ref|YP_005506162.1| gi|294505078|ref|YP_003569140.1| gi|384138783|ref|YP_005521485.1| gi|145600245|ref|YP_001164321.1| gi|218930388|ref|YP_002348263.1| 187410.y0819 214092.YPO3371 229193.YP_0315 360102.YPA_2869 377628.YPN_0721 386656.YPDSF_2988 gi|108808860|ref|YP_652776.1| WP_002209382.1.100083 WP_002209382.1.100246 WP_002209382.1.100921 WP_002209382.1.100931 WP_002209382.1.10105 WP_002209382.1.101305 WP_002209382.1.101382 WP_002209382.1.101928 WP_002209382.1.102012 WP_002209382.1.102067 WP_002209382.1.10736 WP_002209382.1.10935 WP_002209382.1.10955 WP_002209382.1.11693 WP_002209382.1.12463 WP_002209382.1.12857 WP_002209382.1.1388 WP_002209382.1.14063 WP_002209382.1.14804 WP_002209382.1.15321 WP_002209382.1.15555 WP_002209382.1.15605 WP_002209382.1.15689 WP_002209382.1.16243 WP_002209382.1.16333 WP_002209382.1.17135 WP_002209382.1.17141 WP_002209382.1.17608 WP_002209382.1.17873 WP_002209382.1.17983 WP_002209382.1.18208 WP_002209382.1.18640 WP_002209382.1.18826 WP_002209382.1.19329 WP_002209382.1.19425 WP_002209382.1.19739 WP_002209382.1.19763 WP_002209382.1.20035 WP_002209382.1.2064 WP_002209382.1.21486 WP_002209382.1.21784 WP_002209382.1.21879 WP_002209382.1.21934 WP_002209382.1.22530 WP_002209382.1.22542 WP_002209382.1.22708 WP_002209382.1.23157 WP_002209382.1.23271 WP_002209382.1.23687 WP_002209382.1.23811 WP_002209382.1.24002 WP_002209382.1.2451 WP_002209382.1.25394 WP_002209382.1.2640 WP_002209382.1.26776 WP_002209382.1.26960 WP_002209382.1.27124 WP_002209382.1.27251 WP_002209382.1.2726 WP_002209382.1.28647 WP_002209382.1.28922 WP_002209382.1.29157 WP_002209382.1.29355 WP_002209382.1.2947 WP_002209382.1.29622 WP_002209382.1.2964 WP_002209382.1.29685 WP_002209382.1.29814 WP_002209382.1.3092 WP_002209382.1.30931 WP_002209382.1.311 WP_002209382.1.31336 WP_002209382.1.31496 WP_002209382.1.31739 WP_002209382.1.31805 WP_002209382.1.32343 WP_002209382.1.32388 WP_002209382.1.32446 WP_002209382.1.33203 WP_002209382.1.33661 WP_002209382.1.33937 WP_002209382.1.34031 WP_002209382.1.34138 WP_002209382.1.35389 WP_002209382.1.35538 WP_002209382.1.36088 WP_002209382.1.37174 WP_002209382.1.37494 WP_002209382.1.37863 WP_002209382.1.38147 WP_002209382.1.38235 WP_002209382.1.38743 WP_002209382.1.38824 WP_002209382.1.38993 WP_002209382.1.39346 WP_002209382.1.3976 WP_002209382.1.40071 WP_002209382.1.40134 WP_002209382.1.40853 WP_002209382.1.41196 WP_002209382.1.42490 WP_002209382.1.44408 WP_002209382.1.44598 WP_002209382.1.44603 WP_002209382.1.44832 WP_002209382.1.45198 WP_002209382.1.45214 WP_002209382.1.46262 WP_002209382.1.46545 WP_002209382.1.46686 WP_002209382.1.4678 WP_002209382.1.46891 WP_002209382.1.47387 WP_002209382.1.48166 WP_002209382.1.48722 WP_002209382.1.4889 WP_002209382.1.49906 WP_002209382.1.4997 WP_002209382.1.50010 WP_002209382.1.50093 WP_002209382.1.50106 WP_002209382.1.50984 WP_002209382.1.51284 WP_002209382.1.51293 WP_002209382.1.51588 WP_002209382.1.51772 WP_002209382.1.51934 WP_002209382.1.52158 WP_002209382.1.52247 WP_002209382.1.52734 WP_002209382.1.52819 WP_002209382.1.52969 WP_002209382.1.53300 WP_002209382.1.53838 WP_002209382.1.53848 WP_002209382.1.53953 WP_002209382.1.54568 WP_002209382.1.54951 WP_002209382.1.55194 WP_002209382.1.55695 WP_002209382.1.5592 WP_002209382.1.56031 WP_002209382.1.56912 WP_002209382.1.56953 WP_002209382.1.57585 WP_002209382.1.57657 WP_002209382.1.58067 WP_002209382.1.58794 WP_002209382.1.59102 WP_002209382.1.59431 WP_002209382.1.5957 WP_002209382.1.59635 WP_002209382.1.59687 WP_002209382.1.59789 WP_002209382.1.59885 WP_002209382.1.60437 WP_002209382.1.60707 WP_002209382.1.61689 WP_002209382.1.62232 WP_002209382.1.62342 WP_002209382.1.6270 WP_002209382.1.63387 WP_002209382.1.64142 WP_002209382.1.64474 WP_002209382.1.64780 WP_002209382.1.64786 WP_002209382.1.64910 WP_002209382.1.653 WP_002209382.1.65400 WP_002209382.1.6570 WP_002209382.1.65706 WP_002209382.1.65718 WP_002209382.1.6581 WP_002209382.1.66546 WP_002209382.1.66616 WP_002209382.1.67404 WP_002209382.1.67850 WP_002209382.1.68361 WP_002209382.1.68855 WP_002209382.1.69018 WP_002209382.1.69316 WP_002209382.1.69951 WP_002209382.1.70117 WP_002209382.1.70171 WP_002209382.1.70319 WP_002209382.1.70377 WP_002209382.1.70417 WP_002209382.1.70726 WP_002209382.1.7083 WP_002209382.1.7169 WP_002209382.1.71744 WP_002209382.1.72280 WP_002209382.1.72440 WP_002209382.1.72486 WP_002209382.1.7402 WP_002209382.1.74131 WP_002209382.1.74738 WP_002209382.1.7518 WP_002209382.1.75337 WP_002209382.1.75407 WP_002209382.1.75636 WP_002209382.1.75689 WP_002209382.1.75821 WP_002209382.1.76670 WP_002209382.1.77387 WP_002209382.1.77691 WP_002209382.1.78004 WP_002209382.1.7841 WP_002209382.1.78556 WP_002209382.1.79515 WP_002209382.1.79550 WP_002209382.1.79609 WP_002209382.1.79981 WP_002209382.1.8009 WP_002209382.1.80331 WP_002209382.1.81848 WP_002209382.1.81877 WP_002209382.1.82133 WP_002209382.1.82151 WP_002209382.1.82270 WP_002209382.1.82619 WP_002209382.1.8303 WP_002209382.1.83039 WP_002209382.1.83265 WP_002209382.1.8420 WP_002209382.1.84703 WP_002209382.1.84720 WP_002209382.1.85269 WP_002209382.1.8559 WP_002209382.1.85802 WP_002209382.1.86034 WP_002209382.1.86413 WP_002209382.1.87107 WP_002209382.1.87418 WP_002209382.1.8762 WP_002209382.1.87988 WP_002209382.1.88362 WP_002209382.1.88472 WP_002209382.1.89359 WP_002209382.1.8964 WP_002209382.1.90176 WP_002209382.1.9051 WP_002209382.1.90624 WP_002209382.1.91373 WP_002209382.1.91844 WP_002209382.1.92030 WP_002209382.1.92331 WP_002209382.1.92604 WP_002209382.1.927 WP_002209382.1.9311 WP_002209382.1.9320 WP_002209382.1.93623 WP_002209382.1.93928 WP_002209382.1.93933 WP_002209382.1.94052 WP_002209382.1.94201 WP_002209382.1.94545 WP_002209382.1.94683 WP_002209382.1.95746 WP_002209382.1.95981 WP_002209382.1.97245 WP_002209382.1.97375 WP_002209382.1.97448 WP_002209382.1.97791 WP_002209382.1.97864 WP_002209382.1.97872 WP_002209382.1.97894 WP_002209382.1.99109 WP_002209382.1.99383 WP_002209382.1.9941 WP_002209382.1.99416 WP_002209382.1.99788 WP_002209382.1.99990 YP_002348263.1.25044 gi|22124732|ref|NP_668155.1| gi|384127404|ref|YP_005510018.1| gi|45440174|ref|NP_991713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]