SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384127819|ref|YP_005510433.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127819|ref|YP_005510433.1|
Domain Number 1 Region: 1-35,133-200,254-418
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.33e-24
Family HI0933 N-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384127819|ref|YP_005510433.1|
Sequence length 424
Comment anaerobic glycerol-3-phosphate dehydrogenase subunit B [Yersinia pestis D182038]
Sequence
MKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSSGQNALHFSSGSLDLLAKLPDGQAVSQP
LSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRRCGLDIVGSSAENHLRLTPLGSC
RPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQPQMVASALQDQGIDATADYLHLPA
LDRLRDNPSEFRAVNIARILDLPENRQPLADELSRLSSTAEMILLPACIGLDKSAPLDAL
RAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGLVMPGDAVLRAELVDNRITGLYSR
NHGDIPLRAAQMVLASGSFFSNGLVATFDKIYEPILDLDILSLPHRADWSHSNLFAPQPY
LQFGVNTDNHLRPLRGGVALENLHAIGAVLGGYDPLQQGCGAGVSLTSAVFVAEQIISEM
AVTL
Download sequence
Identical sequences A0A0E1NZ48 A0A0M1V509 A0A154T9G7 A0A208S2C9 Q1CBK6 Q1CNF8 Q8ZAH6
gi|384138316|ref|YP_005521018.1| gi|162419627|ref|YP_001605157.1| gi|384123958|ref|YP_005506578.1| gi|218930828|ref|YP_002348703.1| gi|294505489|ref|YP_003569551.1| gi|108810305|ref|YP_646072.1| 214092.YPO3825 349746.YpAngola_A0566 360102.YPA_0197 377628.YPN_0139 386656.YPDSF_3442 gi|384127819|ref|YP_005510433.1| WP_002211492.1.100083 WP_002211492.1.100246 WP_002211492.1.100921 WP_002211492.1.100931 WP_002211492.1.10105 WP_002211492.1.101305 WP_002211492.1.101382 WP_002211492.1.101928 WP_002211492.1.102012 WP_002211492.1.102067 WP_002211492.1.10955 WP_002211492.1.11693 WP_002211492.1.12463 WP_002211492.1.12736 WP_002211492.1.12857 WP_002211492.1.1388 WP_002211492.1.14063 WP_002211492.1.14804 WP_002211492.1.15321 WP_002211492.1.15605 WP_002211492.1.16243 WP_002211492.1.16333 WP_002211492.1.17135 WP_002211492.1.17141 WP_002211492.1.17608 WP_002211492.1.17873 WP_002211492.1.17983 WP_002211492.1.18640 WP_002211492.1.18826 WP_002211492.1.19425 WP_002211492.1.19739 WP_002211492.1.20035 WP_002211492.1.2064 WP_002211492.1.21486 WP_002211492.1.21784 WP_002211492.1.21879 WP_002211492.1.21934 WP_002211492.1.22542 WP_002211492.1.22708 WP_002211492.1.23157 WP_002211492.1.23271 WP_002211492.1.23687 WP_002211492.1.23811 WP_002211492.1.24002 WP_002211492.1.2451 WP_002211492.1.25181 WP_002211492.1.25394 WP_002211492.1.2640 WP_002211492.1.26776 WP_002211492.1.26960 WP_002211492.1.27124 WP_002211492.1.27251 WP_002211492.1.2726 WP_002211492.1.28647 WP_002211492.1.28922 WP_002211492.1.29157 WP_002211492.1.29355 WP_002211492.1.2947 WP_002211492.1.29622 WP_002211492.1.2964 WP_002211492.1.29685 WP_002211492.1.29814 WP_002211492.1.3092 WP_002211492.1.31336 WP_002211492.1.31496 WP_002211492.1.31739 WP_002211492.1.32343 WP_002211492.1.32388 WP_002211492.1.32446 WP_002211492.1.33203 WP_002211492.1.33661 WP_002211492.1.33937 WP_002211492.1.34031 WP_002211492.1.34138 WP_002211492.1.35389 WP_002211492.1.35538 WP_002211492.1.36088 WP_002211492.1.37174 WP_002211492.1.37494 WP_002211492.1.37863 WP_002211492.1.38147 WP_002211492.1.38235 WP_002211492.1.38743 WP_002211492.1.38824 WP_002211492.1.39346 WP_002211492.1.3976 WP_002211492.1.40071 WP_002211492.1.40134 WP_002211492.1.40534 WP_002211492.1.40853 WP_002211492.1.41196 WP_002211492.1.4210 WP_002211492.1.42490 WP_002211492.1.44408 WP_002211492.1.44603 WP_002211492.1.45198 WP_002211492.1.45214 WP_002211492.1.46262 WP_002211492.1.46545 WP_002211492.1.46686 WP_002211492.1.46731 WP_002211492.1.4678 WP_002211492.1.46891 WP_002211492.1.47387 WP_002211492.1.47440 WP_002211492.1.48166 WP_002211492.1.48722 WP_002211492.1.4889 WP_002211492.1.49906 WP_002211492.1.4997 WP_002211492.1.50010 WP_002211492.1.50093 WP_002211492.1.50106 WP_002211492.1.50984 WP_002211492.1.51284 WP_002211492.1.51293 WP_002211492.1.51588 WP_002211492.1.51772 WP_002211492.1.51934 WP_002211492.1.52158 WP_002211492.1.52734 WP_002211492.1.52819 WP_002211492.1.52969 WP_002211492.1.53300 WP_002211492.1.53838 WP_002211492.1.53953 WP_002211492.1.54568 WP_002211492.1.54951 WP_002211492.1.55194 WP_002211492.1.55695 WP_002211492.1.5592 WP_002211492.1.56912 WP_002211492.1.56953 WP_002211492.1.57585 WP_002211492.1.57657 WP_002211492.1.58067 WP_002211492.1.58794 WP_002211492.1.59102 WP_002211492.1.59431 WP_002211492.1.5957 WP_002211492.1.59635 WP_002211492.1.59687 WP_002211492.1.59789 WP_002211492.1.59885 WP_002211492.1.60437 WP_002211492.1.60707 WP_002211492.1.61689 WP_002211492.1.62232 WP_002211492.1.62342 WP_002211492.1.6270 WP_002211492.1.63387 WP_002211492.1.64142 WP_002211492.1.64474 WP_002211492.1.64780 WP_002211492.1.64786 WP_002211492.1.64910 WP_002211492.1.65400 WP_002211492.1.65554 WP_002211492.1.6570 WP_002211492.1.65706 WP_002211492.1.65718 WP_002211492.1.6581 WP_002211492.1.66118 WP_002211492.1.66546 WP_002211492.1.66616 WP_002211492.1.67404 WP_002211492.1.67850 WP_002211492.1.68361 WP_002211492.1.68753 WP_002211492.1.68855 WP_002211492.1.69018 WP_002211492.1.69316 WP_002211492.1.69951 WP_002211492.1.70117 WP_002211492.1.70171 WP_002211492.1.70319 WP_002211492.1.70377 WP_002211492.1.70417 WP_002211492.1.70726 WP_002211492.1.7083 WP_002211492.1.7169 WP_002211492.1.71744 WP_002211492.1.72280 WP_002211492.1.72440 WP_002211492.1.72486 WP_002211492.1.74131 WP_002211492.1.74738 WP_002211492.1.75173 WP_002211492.1.7518 WP_002211492.1.75407 WP_002211492.1.75636 WP_002211492.1.75821 WP_002211492.1.76670 WP_002211492.1.77387 WP_002211492.1.77429 WP_002211492.1.77691 WP_002211492.1.78004 WP_002211492.1.7841 WP_002211492.1.78556 WP_002211492.1.79515 WP_002211492.1.79609 WP_002211492.1.79981 WP_002211492.1.8009 WP_002211492.1.80331 WP_002211492.1.81848 WP_002211492.1.81877 WP_002211492.1.8210 WP_002211492.1.82133 WP_002211492.1.82151 WP_002211492.1.82270 WP_002211492.1.82619 WP_002211492.1.8303 WP_002211492.1.83265 WP_002211492.1.8420 WP_002211492.1.84703 WP_002211492.1.84720 WP_002211492.1.85269 WP_002211492.1.85270 WP_002211492.1.8559 WP_002211492.1.85802 WP_002211492.1.86034 WP_002211492.1.86413 WP_002211492.1.87107 WP_002211492.1.8728 WP_002211492.1.87418 WP_002211492.1.8762 WP_002211492.1.87853 WP_002211492.1.87988 WP_002211492.1.88362 WP_002211492.1.88472 WP_002211492.1.89359 WP_002211492.1.8964 WP_002211492.1.9051 WP_002211492.1.90624 WP_002211492.1.91373 WP_002211492.1.91844 WP_002211492.1.92030 WP_002211492.1.92331 WP_002211492.1.92604 WP_002211492.1.927 WP_002211492.1.9311 WP_002211492.1.9320 WP_002211492.1.93928 WP_002211492.1.93933 WP_002211492.1.94052 WP_002211492.1.94201 WP_002211492.1.94683 WP_002211492.1.95746 WP_002211492.1.95981 WP_002211492.1.97245 WP_002211492.1.97448 WP_002211492.1.97791 WP_002211492.1.97864 WP_002211492.1.97872 WP_002211492.1.97894 WP_002211492.1.99109 WP_002211492.1.99383 WP_002211492.1.9941 WP_002211492.1.99416 WP_002211492.1.99788 WP_002211492.1.99990 YP_002348703.1.25044 gi|145600692|ref|YP_001164768.1| gi|108806195|ref|YP_650111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]