SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127820|ref|YP_005510434.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127820|ref|YP_005510434.1|
Domain Number 1 Region: 10-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.12e-45
Family FAD-linked reductases, N-terminal domain 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|384127820|ref|YP_005510434.1|
Domain Number - Region: 456-532
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 0.00667
Family PA2201 C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384127820|ref|YP_005510434.1|
Sequence length 551
Comment anaerobic glycerol-3-phosphate dehydrogenase subunit A [Yersinia pestis D182038]
Sequence
MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAYQLQFIARCRDAGIEAE
AIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAREHGANILTYHEVIGLLR
QGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYADLRIRMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDNMVVTAQEVDTLIREGAKLS
PQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHASRDGVEGFITITGGKLMTYR
LMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLSKVISLPASIRGSAVYRHGDRA
TQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLLDLRRRTRVGMGTCQGELCACRA
AGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGDALRESEFTQWVYQGLCGLDEIPA
TVNAREKHDEI
Download sequence
Identical sequences A0A0E1NST2 A0A0H2YE72 A0A0H3B7D9 A0A0M1V516 A0A0U1EVI3 A0A208S2T3 Q0WAI4 Q66FX6 Q7CKX5
gi|294505490|ref|YP_003569552.1| gi|22124319|ref|NP_667742.1| gi|108810304|ref|YP_646071.1| gi|186893566|ref|YP_001870678.1| gi|384138315|ref|YP_005521017.1| gi|51594564|ref|YP_068755.1| gi|218930829|ref|YP_002348704.1| 187410.y0404 214092.YPO3826 229193.YP_3222 273123.YPTB0209 360102.YPA_0196 377628.YPN_0138 386656.YPDSF_3443 502800.YPK_3991 502801.YPTS_0224 gi|108806194|ref|YP_650110.1| WP_002211491.1.100083 WP_002211491.1.100246 WP_002211491.1.100921 WP_002211491.1.10105 WP_002211491.1.102012 WP_002211491.1.102067 WP_002211491.1.10736 WP_002211491.1.11693 WP_002211491.1.12857 WP_002211491.1.1388 WP_002211491.1.14063 WP_002211491.1.15555 WP_002211491.1.15605 WP_002211491.1.16243 WP_002211491.1.16333 WP_002211491.1.17135 WP_002211491.1.17141 WP_002211491.1.17608 WP_002211491.1.17873 WP_002211491.1.17983 WP_002211491.1.18208 WP_002211491.1.18826 WP_002211491.1.19329 WP_002211491.1.19425 WP_002211491.1.19763 WP_002211491.1.20380 WP_002211491.1.2064 WP_002211491.1.20932 WP_002211491.1.21784 WP_002211491.1.21879 WP_002211491.1.22530 WP_002211491.1.23157 WP_002211491.1.23687 WP_002211491.1.23811 WP_002211491.1.24002 WP_002211491.1.2451 WP_002211491.1.25181 WP_002211491.1.26383 WP_002211491.1.26960 WP_002211491.1.27124 WP_002211491.1.27251 WP_002211491.1.29157 WP_002211491.1.29355 WP_002211491.1.29622 WP_002211491.1.2964 WP_002211491.1.29685 WP_002211491.1.29814 WP_002211491.1.3092 WP_002211491.1.30931 WP_002211491.1.311 WP_002211491.1.31336 WP_002211491.1.31496 WP_002211491.1.31739 WP_002211491.1.32446 WP_002211491.1.32736 WP_002211491.1.33324 WP_002211491.1.33937 WP_002211491.1.34138 WP_002211491.1.35389 WP_002211491.1.36088 WP_002211491.1.37494 WP_002211491.1.38235 WP_002211491.1.38824 WP_002211491.1.38993 WP_002211491.1.39066 WP_002211491.1.3976 WP_002211491.1.39858 WP_002211491.1.40071 WP_002211491.1.40134 WP_002211491.1.40853 WP_002211491.1.42490 WP_002211491.1.44408 WP_002211491.1.45214 WP_002211491.1.46262 WP_002211491.1.46545 WP_002211491.1.46686 WP_002211491.1.46697 WP_002211491.1.46731 WP_002211491.1.4678 WP_002211491.1.46891 WP_002211491.1.47387 WP_002211491.1.47440 WP_002211491.1.48722 WP_002211491.1.50185 WP_002211491.1.51284 WP_002211491.1.51293 WP_002211491.1.51588 WP_002211491.1.51772 WP_002211491.1.51934 WP_002211491.1.52158 WP_002211491.1.52734 WP_002211491.1.52792 WP_002211491.1.52819 WP_002211491.1.53838 WP_002211491.1.54568 WP_002211491.1.54951 WP_002211491.1.55194 WP_002211491.1.5592 WP_002211491.1.56912 WP_002211491.1.57585 WP_002211491.1.57657 WP_002211491.1.58067 WP_002211491.1.59431 WP_002211491.1.59789 WP_002211491.1.59885 WP_002211491.1.60437 WP_002211491.1.60707 WP_002211491.1.60896 WP_002211491.1.62232 WP_002211491.1.63641 WP_002211491.1.64780 WP_002211491.1.64910 WP_002211491.1.65400 WP_002211491.1.65554 WP_002211491.1.6570 WP_002211491.1.65706 WP_002211491.1.65718 WP_002211491.1.6581 WP_002211491.1.66118 WP_002211491.1.66546 WP_002211491.1.66616 WP_002211491.1.67850 WP_002211491.1.69316 WP_002211491.1.69951 WP_002211491.1.70319 WP_002211491.1.70377 WP_002211491.1.70417 WP_002211491.1.70726 WP_002211491.1.7083 WP_002211491.1.7169 WP_002211491.1.71744 WP_002211491.1.72280 WP_002211491.1.72486 WP_002211491.1.7402 WP_002211491.1.74131 WP_002211491.1.74738 WP_002211491.1.7518 WP_002211491.1.75208 WP_002211491.1.75337 WP_002211491.1.75636 WP_002211491.1.77387 WP_002211491.1.77429 WP_002211491.1.77691 WP_002211491.1.78004 WP_002211491.1.7841 WP_002211491.1.78556 WP_002211491.1.79981 WP_002211491.1.8009 WP_002211491.1.80331 WP_002211491.1.8210 WP_002211491.1.82133 WP_002211491.1.82619 WP_002211491.1.8303 WP_002211491.1.83265 WP_002211491.1.84703 WP_002211491.1.84720 WP_002211491.1.85269 WP_002211491.1.85270 WP_002211491.1.85802 WP_002211491.1.86034 WP_002211491.1.87107 WP_002211491.1.8728 WP_002211491.1.8762 WP_002211491.1.87853 WP_002211491.1.87988 WP_002211491.1.88472 WP_002211491.1.89359 WP_002211491.1.8964 WP_002211491.1.90176 WP_002211491.1.90624 WP_002211491.1.91373 WP_002211491.1.91844 WP_002211491.1.92030 WP_002211491.1.92331 WP_002211491.1.9311 WP_002211491.1.93623 WP_002211491.1.93928 WP_002211491.1.94052 WP_002211491.1.94201 WP_002211491.1.94545 WP_002211491.1.94683 WP_002211491.1.95981 WP_002211491.1.97864 WP_002211491.1.97894 WP_002211491.1.99109 WP_002211491.1.99788 WP_002211491.1.99882 WP_002211491.1.99990 YP_002348704.1.25044 gi|145600693|ref|YP_001164769.1| gi|384123959|ref|YP_005506579.1| gi|384127820|ref|YP_005510434.1| gi|170026202|ref|YP_001722707.1| gi|45442974|ref|NP_994513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]