SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127897|ref|YP_005510511.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127897|ref|YP_005510511.1|
Domain Number 1 Region: 1-322
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 
Domain Number 2 Region: 345-463
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384127897|ref|YP_005510511.1|
Sequence length 466
Comment soluble pyridine nucleotide transhydrogenase [Yersinia pestis D182038]
Sequence
MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAV
SRIIEFNQNPLYSDNARTIKSSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFI
DANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNHERIYDSDTILQLSHEPQHVI
IYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQ
TALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVG
KTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILFHRETKQILGIHCFGERAAEI
IHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF
Download sequence
Identical sequences A0A0E1NS40 A0A0M1VB94 A0A0T9R297 A0A0T9R9V8 A0A0U1EX92 A0A154SAU0 A0A208RWG2 A4TRG4 A7FD10 A9R6N5 B1JQ50 B2JZF3 Q1CBU5 Q1CNP4 Q66G61 Q8ZA97
gi|170026285|ref|YP_001722790.1| gi|384124035|ref|YP_005506655.1| 187410.y0321 214092.YPO3914 229193.YP_3134 273123.YPTB0121 349746.YpAngola_A0118 349747.YpsIP31758_0137 360102.YPA_0108 377628.YPN_0053 386656.YPDSF_3526 502800.YPK_4078 502801.YPTS_0127 gi|51594479|ref|YP_068670.1| gi|162420661|ref|YP_001604755.1| gi|384412984|ref|YP_005622346.1| WP_002209477.1.100083 WP_002209477.1.100246 WP_002209477.1.100593 WP_002209477.1.10066 WP_002209477.1.100921 WP_002209477.1.100931 WP_002209477.1.10105 WP_002209477.1.101305 WP_002209477.1.101382 WP_002209477.1.101928 WP_002209477.1.102012 WP_002209477.1.102067 WP_002209477.1.10535 WP_002209477.1.10736 WP_002209477.1.10935 WP_002209477.1.10955 WP_002209477.1.11800 WP_002209477.1.12167 WP_002209477.1.12463 WP_002209477.1.12736 WP_002209477.1.12857 WP_002209477.1.1388 WP_002209477.1.14063 WP_002209477.1.14169 WP_002209477.1.14804 WP_002209477.1.15321 WP_002209477.1.15555 WP_002209477.1.15605 WP_002209477.1.15689 WP_002209477.1.16243 WP_002209477.1.16333 WP_002209477.1.17135 WP_002209477.1.17141 WP_002209477.1.17608 WP_002209477.1.17873 WP_002209477.1.17983 WP_002209477.1.18208 WP_002209477.1.18640 WP_002209477.1.18826 WP_002209477.1.19329 WP_002209477.1.19425 WP_002209477.1.19739 WP_002209477.1.19763 WP_002209477.1.20035 WP_002209477.1.20380 WP_002209477.1.20547 WP_002209477.1.2064 WP_002209477.1.20932 WP_002209477.1.21486 WP_002209477.1.21784 WP_002209477.1.21879 WP_002209477.1.21934 WP_002209477.1.22530 WP_002209477.1.22542 WP_002209477.1.22708 WP_002209477.1.23157 WP_002209477.1.23271 WP_002209477.1.23687 WP_002209477.1.23811 WP_002209477.1.24002 WP_002209477.1.24517 WP_002209477.1.25181 WP_002209477.1.25394 WP_002209477.1.26383 WP_002209477.1.2640 WP_002209477.1.26776 WP_002209477.1.26960 WP_002209477.1.27251 WP_002209477.1.2726 WP_002209477.1.28647 WP_002209477.1.28922 WP_002209477.1.29157 WP_002209477.1.29186 WP_002209477.1.29355 WP_002209477.1.2947 WP_002209477.1.29622 WP_002209477.1.2964 WP_002209477.1.29685 WP_002209477.1.29814 WP_002209477.1.3092 WP_002209477.1.30931 WP_002209477.1.311 WP_002209477.1.31336 WP_002209477.1.31496 WP_002209477.1.31721 WP_002209477.1.31739 WP_002209477.1.31805 WP_002209477.1.32343 WP_002209477.1.32388 WP_002209477.1.32446 WP_002209477.1.32736 WP_002209477.1.33324 WP_002209477.1.33661 WP_002209477.1.33775 WP_002209477.1.33937 WP_002209477.1.34031 WP_002209477.1.34138 WP_002209477.1.35389 WP_002209477.1.35538 WP_002209477.1.36088 WP_002209477.1.37494 WP_002209477.1.37863 WP_002209477.1.38147 WP_002209477.1.38235 WP_002209477.1.38532 WP_002209477.1.38743 WP_002209477.1.38824 WP_002209477.1.38993 WP_002209477.1.39066 WP_002209477.1.39346 WP_002209477.1.3976 WP_002209477.1.39858 WP_002209477.1.40071 WP_002209477.1.40110 WP_002209477.1.40134 WP_002209477.1.40534 WP_002209477.1.40853 WP_002209477.1.41196 WP_002209477.1.4210 WP_002209477.1.42361 WP_002209477.1.42490 WP_002209477.1.42976 WP_002209477.1.44408 WP_002209477.1.44598 WP_002209477.1.44603 WP_002209477.1.44832 WP_002209477.1.45198 WP_002209477.1.45214 WP_002209477.1.46262 WP_002209477.1.46545 WP_002209477.1.46686 WP_002209477.1.46697 WP_002209477.1.46731 WP_002209477.1.4678 WP_002209477.1.46891 WP_002209477.1.47387 WP_002209477.1.47440 WP_002209477.1.47881 WP_002209477.1.48166 WP_002209477.1.48722 WP_002209477.1.4889 WP_002209477.1.49315 WP_002209477.1.49906 WP_002209477.1.4997 WP_002209477.1.50010 WP_002209477.1.50093 WP_002209477.1.50106 WP_002209477.1.50185 WP_002209477.1.50984 WP_002209477.1.51293 WP_002209477.1.51588 WP_002209477.1.51772 WP_002209477.1.51934 WP_002209477.1.52158 WP_002209477.1.52167 WP_002209477.1.52734 WP_002209477.1.52792 WP_002209477.1.52819 WP_002209477.1.53147 WP_002209477.1.53300 WP_002209477.1.53838 WP_002209477.1.53848 WP_002209477.1.53883 WP_002209477.1.53953 WP_002209477.1.54568 WP_002209477.1.54951 WP_002209477.1.55194 WP_002209477.1.55695 WP_002209477.1.5592 WP_002209477.1.56031 WP_002209477.1.56912 WP_002209477.1.56953 WP_002209477.1.57585 WP_002209477.1.57657 WP_002209477.1.58067 WP_002209477.1.58543 WP_002209477.1.58794 WP_002209477.1.59102 WP_002209477.1.59324 WP_002209477.1.59431 WP_002209477.1.5957 WP_002209477.1.59635 WP_002209477.1.5968 WP_002209477.1.59687 WP_002209477.1.59789 WP_002209477.1.59885 WP_002209477.1.60437 WP_002209477.1.60707 WP_002209477.1.61689 WP_002209477.1.62232 WP_002209477.1.6270 WP_002209477.1.6333 WP_002209477.1.63387 WP_002209477.1.63641 WP_002209477.1.64142 WP_002209477.1.64474 WP_002209477.1.64780 WP_002209477.1.64910 WP_002209477.1.653 WP_002209477.1.65400 WP_002209477.1.65554 WP_002209477.1.6570 WP_002209477.1.65706 WP_002209477.1.65718 WP_002209477.1.6581 WP_002209477.1.66118 WP_002209477.1.66546 WP_002209477.1.66616 WP_002209477.1.67404 WP_002209477.1.67850 WP_002209477.1.6791 WP_002209477.1.68361 WP_002209477.1.68371 WP_002209477.1.68753 WP_002209477.1.68855 WP_002209477.1.69018 WP_002209477.1.69316 WP_002209477.1.69951 WP_002209477.1.70117 WP_002209477.1.70171 WP_002209477.1.70319 WP_002209477.1.70377 WP_002209477.1.70417 WP_002209477.1.70726 WP_002209477.1.7083 WP_002209477.1.7169 WP_002209477.1.71744 WP_002209477.1.72280 WP_002209477.1.72440 WP_002209477.1.72486 WP_002209477.1.7402 WP_002209477.1.74131 WP_002209477.1.74310 WP_002209477.1.74577 WP_002209477.1.74738 WP_002209477.1.75169 WP_002209477.1.75173 WP_002209477.1.7518 WP_002209477.1.75208 WP_002209477.1.75407 WP_002209477.1.75636 WP_002209477.1.75821 WP_002209477.1.76555 WP_002209477.1.76670 WP_002209477.1.77295 WP_002209477.1.77387 WP_002209477.1.77429 WP_002209477.1.77569 WP_002209477.1.77691 WP_002209477.1.78004 WP_002209477.1.7841 WP_002209477.1.78556 WP_002209477.1.79515 WP_002209477.1.79550 WP_002209477.1.79609 WP_002209477.1.79825 WP_002209477.1.79981 WP_002209477.1.8009 WP_002209477.1.80331 WP_002209477.1.81848 WP_002209477.1.81877 WP_002209477.1.8210 WP_002209477.1.82133 WP_002209477.1.82151 WP_002209477.1.82270 WP_002209477.1.82436 WP_002209477.1.82619 WP_002209477.1.8303 WP_002209477.1.83039 WP_002209477.1.83102 WP_002209477.1.83265 WP_002209477.1.83630 WP_002209477.1.8420 WP_002209477.1.84703 WP_002209477.1.84720 WP_002209477.1.85269 WP_002209477.1.8559 WP_002209477.1.85802 WP_002209477.1.86034 WP_002209477.1.86059 WP_002209477.1.86413 WP_002209477.1.87107 WP_002209477.1.8728 WP_002209477.1.87418 WP_002209477.1.8762 WP_002209477.1.87853 WP_002209477.1.87988 WP_002209477.1.88362 WP_002209477.1.88472 WP_002209477.1.89359 WP_002209477.1.89542 WP_002209477.1.8964 WP_002209477.1.90176 WP_002209477.1.9051 WP_002209477.1.90624 WP_002209477.1.91263 WP_002209477.1.91373 WP_002209477.1.91844 WP_002209477.1.92030 WP_002209477.1.92331 WP_002209477.1.92604 WP_002209477.1.927 WP_002209477.1.9311 WP_002209477.1.9320 WP_002209477.1.93623 WP_002209477.1.93928 WP_002209477.1.93933 WP_002209477.1.94052 WP_002209477.1.94201 WP_002209477.1.94545 WP_002209477.1.94683 WP_002209477.1.95981 WP_002209477.1.97245 WP_002209477.1.97448 WP_002209477.1.97791 WP_002209477.1.97872 WP_002209477.1.97894 WP_002209477.1.99109 WP_002209477.1.99383 WP_002209477.1.9941 WP_002209477.1.99416 WP_002209477.1.99788 WP_002209477.1.99882 WP_002209477.1.99972 WP_002209477.1.99990 YP_002348789.1.25044 gi|384127897|ref|YP_005510511.1| gi|294505564|ref|YP_003569626.1| gi|153947678|ref|YP_001399138.1| gi|186893471|ref|YP_001870583.1| gi|145600773|ref|YP_001164849.1| gi|161484907|ref|NP_667661.2| gi|384138232|ref|YP_005520934.1| gi|218930914|ref|YP_002348789.1| gi|108810219|ref|YP_645986.1| gi|108806106|ref|YP_650022.1| gi|45442888|ref|NP_994427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]