SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384127914|ref|YP_005510528.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127914|ref|YP_005510528.1|
Domain Number 1 Region: 1-260,312-374
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.76e-36
Family FAD-linked reductases, N-terminal domain 0.092
Further Details:      
 
Domain Number 2 Region: 226-319
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000216
Family D-aminoacid oxidase-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384127914|ref|YP_005510528.1|
Sequence length 504
Comment aerobic glycerol-3-phosphate dehydrogenase [Yersinia pestis D182038]
Sequence
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHGGEVRTRTKVTRTWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEMTYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILANATRLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADAHTEKQQALPLVS
Download sequence
Identical sequences WP_002226019.1.15689 WP_002226019.1.21879 WP_002226019.1.25394 WP_002226019.1.32388 WP_002226019.1.33203 WP_002226019.1.36088 WP_002226019.1.39346 WP_002226019.1.44598 WP_002226019.1.44603 WP_002226019.1.45198 WP_002226019.1.50984 WP_002226019.1.52247 WP_002226019.1.5592 WP_002226019.1.60437 WP_002226019.1.653 WP_002226019.1.69316 WP_002226019.1.7083 WP_002226019.1.72440 WP_002226019.1.79609 WP_002226019.1.8728 WP_002226019.1.9051 WP_002226019.1.97245 gi|384127914|ref|YP_005510528.1| gi|384124052|ref|YP_005506672.1| gi|294504331|ref|YP_003568393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]