SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127938|ref|YP_005510552.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127938|ref|YP_005510552.1|
Domain Number 1 Region: 65-250,399-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.02e-58
Family HI0933 N-terminal domain-like 0.000000377
Further Details:      
 
Domain Number 2 Region: 252-400
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 4.71e-43
Family HI0933 insert domain-like 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384127938|ref|YP_005510552.1|
Sequence length 460
Comment hypothetical protein YPD8_3491 [Yersinia pestis D182038]
Sequence
MYVISASYLVLPNITFSYYGALPAGDLQSPTANLSAEDNQKYDKQPKAGNFAAMMILFNE
ASVEQFDVVVIGAGAAGLFCAAQAGQAGCRVLLVDNGKKAGRKILMSGGGRCNFTNIYTE
PAAYLSQNPHFCKSALARYTQWDFIDLMNRHNIAWHEKTLGQLFCDDSAQQVVDLLLKEC
ELGNVTVRLRSNVLSVEKSDTGFVLHINDLRVSANSLVVASGGLSMPGLGASPFGYKLAE
QFGLKVLPTRAALVPFTLHKPLLDHVQTLSGVSVPAVVTAENGVSFRESILFTHRGLSGP
AILQLSSYWQAGEYVSINLLPDVDLAAFLNTERQAHPNQTLKNTLAQLLPKRLVECLQTL
EQLPDVTLKQLNVPQQAALIANLQQWRVQPNGTEGYRTAEVTLGGVDTQELSSKTMEAHK
VPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQGLAAKK
Download sequence
Identical sequences A0A0H2YDI7 A0A0H2YMA2 A0A0M1VAU8 Q8CZK6
gi|384127938|ref|YP_005510552.1| 187410.y3863 229193.YP_3329 360102.YPA_3794 377628.YPN_3615 gi|108809785|ref|YP_653701.1| gi|294504308|ref|YP_003568370.1| gi|22127734|ref|NP_671157.1| gi|108813775|ref|YP_649542.1| gi|45443078|ref|NP_994617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]