SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384128089|ref|YP_005510703.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384128089|ref|YP_005510703.1|
Domain Number 1 Region: 6-66,97-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.06e-50
Family HI0933 N-terminal domain-like 0.087
Further Details:      
 
Weak hits

Sequence:  gi|384128089|ref|YP_005510703.1|
Domain Number - Region: 585-628
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00122
Family FaeA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384128089|ref|YP_005510703.1|
Sequence length 629
Comment glucose-inhibited division protein A [Yersinia pestis D182038]
Sequence
MFYPDQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEIDALGGLMAKATDLAGIQFRILNASKGPAVRATRAQADRVLYRLAVRTALENQPNLMI
FQQPVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLENYSGGRAGDPPS
ISLSQRLRELPLRVNRLKTGTPPRIDARTIDFSQLTPQLGDTPIPVFSFLGNAEQHPEQM
ACHITYTNEKTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADRNSHQIFLEPE
GLTSNEIYPNGISTSLPFDVQMQIVRSMKGLENARIIRPGYAIEYDFFDPRDLKPTLESK
YIQGLFFAGQINGTTGYEEAAAQGLLAGLNAGRFANEEDGWSPRRDEAYLGVLVDDLSTL
GTKEPYRMFTSRAEYRLMLREDNADLRLTETGRKLGLVDDIRWAHFSQKVEQIEKERQRL
RDIWVHPHSENVSEINALLKAPLSKEANGEELLRRPEIDYRLLTSLTSFGPALTDPQSAD
QVEIQVKYEGYITRQQEEIEKQLRNENTLLPVDLDYQQVSGLSNEVIAKLNDHKPSSIGQ
ASRISGITPAAISILLVWLKKQGLLRRSA
Download sequence
Identical sequences A0A0E1NXH4 A0A0M1V234 A0A0U1EUQ3 A0A208S3W9 A0A2A7VLQ9 A4TSI4 A9R5U9 B1JR32 B2K7J2 Q1C086 Q1CCG6 Q663P9 Q8Z9R8
gi|161484718|ref|NP_671435.2| gi|108810165|ref|YP_654081.1| gi|384416962|ref|YP_005626324.1| gi|384124221|ref|YP_005506841.1| gi|218931106|ref|YP_002348981.1| gi|384138019|ref|YP_005520721.1| gi|145601143|ref|YP_001165219.1| gi|294505652|ref|YP_003569714.1| gi|384128089|ref|YP_005510703.1| WP_002212259.1.100083 WP_002212259.1.100246 WP_002212259.1.100593 WP_002212259.1.10066 WP_002212259.1.100921 WP_002212259.1.100931 WP_002212259.1.10105 WP_002212259.1.101305 WP_002212259.1.101382 WP_002212259.1.101928 WP_002212259.1.102012 WP_002212259.1.102067 WP_002212259.1.10736 WP_002212259.1.10935 WP_002212259.1.10955 WP_002212259.1.11693 WP_002212259.1.12463 WP_002212259.1.12736 WP_002212259.1.12857 WP_002212259.1.1388 WP_002212259.1.14063 WP_002212259.1.15321 WP_002212259.1.15555 WP_002212259.1.15605 WP_002212259.1.15689 WP_002212259.1.16243 WP_002212259.1.16333 WP_002212259.1.17135 WP_002212259.1.17141 WP_002212259.1.17608 WP_002212259.1.17873 WP_002212259.1.17983 WP_002212259.1.18208 WP_002212259.1.18640 WP_002212259.1.18826 WP_002212259.1.19329 WP_002212259.1.19425 WP_002212259.1.19739 WP_002212259.1.19763 WP_002212259.1.20035 WP_002212259.1.20380 WP_002212259.1.20547 WP_002212259.1.2064 WP_002212259.1.20932 WP_002212259.1.21486 WP_002212259.1.21784 WP_002212259.1.21879 WP_002212259.1.21934 WP_002212259.1.22530 WP_002212259.1.22542 WP_002212259.1.22708 WP_002212259.1.23157 WP_002212259.1.23271 WP_002212259.1.23687 WP_002212259.1.23811 WP_002212259.1.24002 WP_002212259.1.2451 WP_002212259.1.24517 WP_002212259.1.25181 WP_002212259.1.25394 WP_002212259.1.26383 WP_002212259.1.2640 WP_002212259.1.26776 WP_002212259.1.26960 WP_002212259.1.27124 WP_002212259.1.27251 WP_002212259.1.2726 WP_002212259.1.28647 WP_002212259.1.28922 WP_002212259.1.29157 WP_002212259.1.29186 WP_002212259.1.29355 WP_002212259.1.2947 WP_002212259.1.29622 WP_002212259.1.2964 WP_002212259.1.29685 WP_002212259.1.29814 WP_002212259.1.3092 WP_002212259.1.30931 WP_002212259.1.311 WP_002212259.1.31336 WP_002212259.1.31496 WP_002212259.1.31721 WP_002212259.1.31739 WP_002212259.1.31805 WP_002212259.1.32343 WP_002212259.1.32388 WP_002212259.1.32446 WP_002212259.1.32736 WP_002212259.1.33203 WP_002212259.1.33324 WP_002212259.1.33661 WP_002212259.1.33775 WP_002212259.1.33937 WP_002212259.1.34031 WP_002212259.1.34138 WP_002212259.1.35389 WP_002212259.1.35538 WP_002212259.1.36088 WP_002212259.1.37174 WP_002212259.1.37494 WP_002212259.1.37863 WP_002212259.1.38147 WP_002212259.1.38235 WP_002212259.1.38532 WP_002212259.1.38743 WP_002212259.1.38824 WP_002212259.1.38993 WP_002212259.1.39066 WP_002212259.1.39346 WP_002212259.1.3976 WP_002212259.1.39858 WP_002212259.1.40071 WP_002212259.1.40134 WP_002212259.1.40534 WP_002212259.1.40853 WP_002212259.1.41196 WP_002212259.1.41984 WP_002212259.1.4210 WP_002212259.1.42361 WP_002212259.1.42490 WP_002212259.1.42976 WP_002212259.1.44408 WP_002212259.1.44598 WP_002212259.1.44603 WP_002212259.1.44832 WP_002212259.1.45198 WP_002212259.1.45214 WP_002212259.1.46262 WP_002212259.1.46545 WP_002212259.1.46686 WP_002212259.1.46697 WP_002212259.1.46731 WP_002212259.1.4678 WP_002212259.1.46891 WP_002212259.1.47387 WP_002212259.1.47769 WP_002212259.1.47881 WP_002212259.1.48166 WP_002212259.1.48722 WP_002212259.1.4889 WP_002212259.1.49315 WP_002212259.1.49906 WP_002212259.1.4997 WP_002212259.1.50010 WP_002212259.1.50093 WP_002212259.1.50106 WP_002212259.1.50185 WP_002212259.1.50984 WP_002212259.1.51284 WP_002212259.1.51293 WP_002212259.1.51588 WP_002212259.1.51772 WP_002212259.1.51934 WP_002212259.1.52158 WP_002212259.1.52247 WP_002212259.1.52734 WP_002212259.1.52792 WP_002212259.1.52819 WP_002212259.1.52969 WP_002212259.1.53147 WP_002212259.1.53300 WP_002212259.1.53838 WP_002212259.1.53848 WP_002212259.1.53883 WP_002212259.1.53953 WP_002212259.1.54568 WP_002212259.1.54951 WP_002212259.1.55194 WP_002212259.1.5592 WP_002212259.1.56031 WP_002212259.1.56912 WP_002212259.1.56953 WP_002212259.1.57585 WP_002212259.1.57657 WP_002212259.1.58067 WP_002212259.1.58794 WP_002212259.1.59102 WP_002212259.1.59431 WP_002212259.1.5957 WP_002212259.1.59635 WP_002212259.1.5968 WP_002212259.1.59687 WP_002212259.1.59789 WP_002212259.1.59885 WP_002212259.1.60437 WP_002212259.1.60707 WP_002212259.1.60896 WP_002212259.1.61689 WP_002212259.1.62232 WP_002212259.1.62342 WP_002212259.1.6270 WP_002212259.1.63387 WP_002212259.1.63641 WP_002212259.1.64142 WP_002212259.1.64474 WP_002212259.1.64780 WP_002212259.1.64786 WP_002212259.1.64910 WP_002212259.1.653 WP_002212259.1.65400 WP_002212259.1.65554 WP_002212259.1.6570 WP_002212259.1.65706 WP_002212259.1.65718 WP_002212259.1.6581 WP_002212259.1.66118 WP_002212259.1.66546 WP_002212259.1.66616 WP_002212259.1.67850 WP_002212259.1.6791 WP_002212259.1.68361 WP_002212259.1.68371 WP_002212259.1.68753 WP_002212259.1.68855 WP_002212259.1.69018 WP_002212259.1.69316 WP_002212259.1.69951 WP_002212259.1.70117 WP_002212259.1.70171 WP_002212259.1.70319 WP_002212259.1.70377 WP_002212259.1.70417 WP_002212259.1.70726 WP_002212259.1.7083 WP_002212259.1.7169 WP_002212259.1.71744 WP_002212259.1.72280 WP_002212259.1.72440 WP_002212259.1.72486 WP_002212259.1.7402 WP_002212259.1.74131 WP_002212259.1.74310 WP_002212259.1.74738 WP_002212259.1.75169 WP_002212259.1.75173 WP_002212259.1.7518 WP_002212259.1.75208 WP_002212259.1.75407 WP_002212259.1.75636 WP_002212259.1.75689 WP_002212259.1.75821 WP_002212259.1.76555 WP_002212259.1.76670 WP_002212259.1.77295 WP_002212259.1.77387 WP_002212259.1.77429 WP_002212259.1.77569 WP_002212259.1.77691 WP_002212259.1.78004 WP_002212259.1.7841 WP_002212259.1.78556 WP_002212259.1.79515 WP_002212259.1.79550 WP_002212259.1.79609 WP_002212259.1.79825 WP_002212259.1.79981 WP_002212259.1.8009 WP_002212259.1.80331 WP_002212259.1.81848 WP_002212259.1.81877 WP_002212259.1.8210 WP_002212259.1.82133 WP_002212259.1.82151 WP_002212259.1.82270 WP_002212259.1.82436 WP_002212259.1.82619 WP_002212259.1.8303 WP_002212259.1.83039 WP_002212259.1.83265 WP_002212259.1.83630 WP_002212259.1.8420 WP_002212259.1.84703 WP_002212259.1.84720 WP_002212259.1.85269 WP_002212259.1.8559 WP_002212259.1.86034 WP_002212259.1.86059 WP_002212259.1.86413 WP_002212259.1.87107 WP_002212259.1.8728 WP_002212259.1.87418 WP_002212259.1.8762 WP_002212259.1.87853 WP_002212259.1.87988 WP_002212259.1.88362 WP_002212259.1.88472 WP_002212259.1.89359 WP_002212259.1.89542 WP_002212259.1.8964 WP_002212259.1.90176 WP_002212259.1.9051 WP_002212259.1.90624 WP_002212259.1.91263 WP_002212259.1.91373 WP_002212259.1.91844 WP_002212259.1.92331 WP_002212259.1.92604 WP_002212259.1.927 WP_002212259.1.9311 WP_002212259.1.9320 WP_002212259.1.93623 WP_002212259.1.93928 WP_002212259.1.93933 WP_002212259.1.94052 WP_002212259.1.94201 WP_002212259.1.94545 WP_002212259.1.94683 WP_002212259.1.95746 WP_002212259.1.95981 WP_002212259.1.97245 WP_002212259.1.97375 WP_002212259.1.97448 WP_002212259.1.97791 WP_002212259.1.97864 WP_002212259.1.97872 WP_002212259.1.97894 WP_002212259.1.99109 WP_002212259.1.9941 WP_002212259.1.99416 WP_002212259.1.99788 WP_002212259.1.99882 WP_002212259.1.99972 YP_002348981.1.25044 gi|186897459|ref|YP_001874571.1| gi|161511281|ref|NP_995299.2| 187410.y4144 214092.YPO4130 229193.YP_4037 273123.YPTB3976 349746.YpAngola_A4212 360102.YPA_4175 377628.YPN_3987 386656.YPDSF_3905 502800.YPK_4217 502801.YPTS_4171 gi|170026421|ref|YP_001722926.1| gi|162421890|ref|YP_001608482.1| gi|108814147|ref|YP_649914.1| gi|51598260|ref|YP_072451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]