SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339322209|ref|YP_004681103.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339322209|ref|YP_004681103.1|
Domain Number 1 Region: 30-263
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.33e-30
Family Phospholipase D 0.069
Further Details:      
 
Domain Number 2 Region: 220-439
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-25
Family Nuclease 0.024
Further Details:      
 
Weak hits

Sequence:  gi|339322209|ref|YP_004681103.1|
Domain Number - Region: 493-724
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0366
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339322209|ref|YP_004681103.1|
Sequence length 753
Comment phospholipase D [Cupriavidus necator N-1]
Sequence
MRQHNPPGTTAPPATGPPHDCQAPLGFTPEPGRNCWRVESCQRFAMLVDADAYFRALREA
LPRAEHTIFILGWDIDSRMELVPQGAQDGLPAGLRDFLCALADQRPELRIYILSWDYAMV
MAMEREWLPSASAHWQAHRHLSFRLDGNHPPGASHHQKVVVIDNKLAFVGGLDLTLRRWD
DSCHAPGAPLRVAEGKPYPPFHDVQCALDGPAAAALGTLCAARWLRASGSQPRPVAATSS
DPWPPGLAPELTDVRVAIARTMPMCEDEPGVSEIRMLLRDAIASARHSIYMENQYFSSHE
IAKALEARLGHEDGPVIVLVSRRNESGWLEAHSMGVLRARLYRRLRAADTQERFCLYCPS
IPGLMPECVNVHSKVTVIDDDLITIGSSNLSNRSLGLDTECNIVVMSGGDPRVQAAIAAM
RARLLGEHLDVAPEAFQAEVAATRSVLAAIRNLQRADGRSLEAYEPPLPDDVDAASPAAS
LLDPIEPIDSDQVLAEFVSHEARPRVLGRVGMMVALALLLAGLAFAWRHTPLREWADFRA
LLSVVEQLDEMPLAPLAMIGVYLAGAVTMLPVTLLILVTVVIFGPLYGAALALCGTVLST
GAGYLAGRLLGRNAVRRFGGRRLNRVSHQLGKHGVVAMVVLRLVPIAPFALVNLVIGASR
ISLRDCLLGTALGMLPSIVVAACLVNRVAAAARDPGLFTFALLALVLLVPASLLLVLRRR
RRRRAEGGAARPQDDPPGPRGRLARLAALRRQA
Download sequence
Identical sequences F8GSV2
WP_013952581.1.32076 gi|339322209|ref|YP_004681103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]