SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339323664|ref|YP_004682558.1| from Cupriavidus necator N-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339323664|ref|YP_004682558.1|
Domain Number 1 Region: 38-234
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.24e-41
Family Phospholipase D 0.027
Further Details:      
 
Domain Number 2 Region: 278-463
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.92e-34
Family Nuclease 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339323664|ref|YP_004682558.1|
Sequence length 527
Comment cardiolipin synthetase [Cupriavidus necator N-1]
Sequence
MTALMLVSALAAGVLAGCASLPASAQRTPSSAPASTADTPLGKVLAPRLAQRPGESLFYP
LSSGPDALAARLAMARAAQRSLDLQTYIFETTGTGAAVLGDILDAADRGVRVRMLLDDLH
TGGMDQILSAIDSHPNIEVRLFNPFANRSVRWLEMLAGFKRLDRRMHNKSMTVDNQMSLV
GGRNIGDAYFSARTDMDFSDLDVLIAGPAVPQVSAVFDEYWNDQSSYPVVALIPAGKEAP
VEMRSLRKGLEARGDQAIASPYVKELLESGLAKSIESGHMPAYSGNAVVVSDSAAKITHQ
TDDDPGYATARLEKMINGAQKEVLLISPYFVPDDDGEAWLIALAKRGIRVRILTNSFAAT
DVSPVHAGYAPHRLALVAAGVELYELKPSAYAELASSGKAARGSRSRSWLSSSRASLHAK
NYIVDRRLVFIGSLNMDPRSAKLNTEMGIVLDSPALAERMIKSTENALLDMTYRVGMQTD
GDGGNRRLTWTTREKGQLMVYDSEPGMGPLQHLGIGVLRVLPIKEEL
Download sequence
Identical sequences F8GU10
gi|339323664|ref|YP_004682558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]