SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|102643|au.11_g3745 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|102643|au.11_g3745
Domain Number - Region: 299-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00019
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|102643|au.11_g3745
Sequence length 511
Sequence
MLSGPLTMRSPAMLLLLLLLLLGFTSAQWKAKTRGPGSAKIKVNLQDSYSSEEAEQEPER
EGWRQTVVRDDSERETREATVTSDDKNEVSGGGTHFAVRIVAPKEGELIRHTPFQVILET
SGGFTVPEDGEIMLTMSYPGRGDDVRVLQSTVFNSWNLHQGEFTISATLVSTKDEPVSPT
VSTRVSQIRGPHFVLTSPEDDQLHISQQTLPVLFHLGGVLPQGSGGCVEISCTHPRDDPF
LFRQCTFDEGNPFSIQDGQHRLDVKISPGNCTITAGVSDANGSPLTPVTSRVFRVVDEQY
ECPGGSGVTCHHGECVEDGEREAHCECDPGYHGKRCLPRWAGEEVGGGRGGVEEAYLHMI
KSALLDTIYAKDRPGETKVNALGCGKKHGGKKSCILMAAILRARGTYQVWVVDSFEGCPK
PDPELYPADNNDQHHTYDNLRVSLHKVTSNLADFGLASSQVEYVKGWFHDTMYTDRIQNI
ENIALLRLDGDLYQSTIEACDQSAHLSLSLQ
Download sequence
Identical sequences L1JSF8
XP_005838352.1.50599 jgi|Guith1|102643|au.11_g3745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]