SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|103205|au.12_g4307 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|103205|au.12_g4307
Domain Number - Region: 203-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000305
Family Integrin beta EGF-like domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|103205|au.12_g4307
Sequence length 606
Sequence
MRGAAVMVMVLTVGVGWALEEGGMREGEETRRGEEEARGNQGGVSMMFPVSWMVGGGGQE
LRVLADSEPPLLFEVRCGKRRENCCLGHDGRRWEIWVDGGLAGQGQGRQRNKLNVSVTSM
GKHAIECLLLEEEKLLHTSSTAVSFAPAGATPRLALPSALGDLLRWGSEDLWAEEEALER
VRAQFFALWDAASREVCPDVANRSTCREHSCSGHGRCSDAGVCLCVGDWFGDICDHHPFL
NSSYLPRELHLSSPSTCPAVVKWSIGSSGLVELLDQLQARRCEEKHPLLLDTLGLALGGQ
INLASLALAHALNQNRSFLLHGRWRYGSHAGCLRQGRACYFQAKLACEEERLRSNGVRVW
PFKDGGAVLEHFNTREVRGGVVAAGRLRVQGLFWWTSHLLAYVTRPSSDLEAKLRALRLQ
LNFAPPLMGLHVRHGDACVHAAQSNTRPLCRPLADYIPAVLKLRRTYGLEAVFLSTDDEE
VVEDATRWLGRHGMRVLHQPLDRSVFESSWFIEHRMEAGALDAGVITDSMLLDLLLLREC
DAFVGTLSSQMSRLALSLMAHRIGVIPPFVSVEDMPWGCCSWAGESLEQKDGEAMRRVSF
GYKEQL
Download sequence
Identical sequences L1JSN8
XP_005838269.1.50599 jgi|Guith1|103205|au.12_g4307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]