SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|107643|au.30_g8745 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|107643|au.30_g8745
Domain Number 1 Region: 117-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Integrin beta EGF-like domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|107643|au.30_g8745
Sequence length 584
Sequence
MLAIKVAHCYSVECGNIVIYLNHKEIGKFRMYANEFGEIRTHLNIPSLCDGEHLAAVKIV
DERGNDLEPHLYHDVGFVVDTAPKEEEEGHQDLSLIDREINNCPQSFSCSSGSSEDDVIC
SGHGACMKGACVCFANWAGEECQHPLFENNTYIPDRDPSSLPSACIKSVVWENRTSELRS
ILLDISERLSCSPQDVLLFEEGRAMVMDGVWNYDACDGLGFACHFLPLSRCSSSDAKAEG
AKLHKRMDNIHYDNPQAYDSHFIPPEFASSFHGVLWWRSQLTGFLLRRNERMELILRRIK
NQIGYRHPVVGVQVLLRSQQLTQLKEGAGCQPVSAFLKHVEAMHERYGVSRVFLATDDIE
TIVHLPLDRTMFDSSLFIEYRLMLGYVDSKAVSDSTVTDLLLLAEADYFVGGFGSHFSRI
SFELSVALKGRVPPYASVDYPWCWHFLEKRPIADEKEEKVVEGGRDGKGKGGRNVLERKN
RGGADASDLMALLVGRQRGNGEDEAEDMSKEEREDDRGVGHEEQEHEQEKEQEQEQEQEQ
EQEQEKEKGKQQQQQGEEEEGERGRGTTDNISHPRSKVMVKVPA
Download sequence
Identical sequences L1JE73
jgi|Guith1|107643|au.30_g8745 XP_005833419.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]