SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|108224|au.33_g9326 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|108224|au.33_g9326
Domain Number 1 Region: 322-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000058
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|108224|au.33_g9326
Sequence length 761
Sequence
MVSSRKTRSGLVVCIIAVMSFEAAVCNTPDEMGEDKQCFAIIHPPQAHMMDVEDHQQLPC
LLRINCQGYGKARRLGLVNGDTTTWVSAEIEPGPDVEMAMIELTINQIYRGRPSLEFVLT
RSSNQSLSEKDANFEVSEFASVDIKSGRLFHPTLEVIFPPQDFVFKQGVTPLVITTVEED
EEGNRVSGPVNLIATRACPMFDRPAAIEGSIFPGRLRMIIKRVGHDPAQGLCDDPYHESV
GEVWYQGCSSHKLCDLPDLPDGDFLLQIYLADAHGEIYAHEERRIKVDTSDVYQSERSSS
DASSCVVRQGRQEGCGNKSEGDGECSSNGACVVLGGDHNRGGGFYCLCSPSYFGKFCEHV
RVSLSGQLLDSLKFCQDIYSTSEYLPSSHPEADESTCPKAEMLLDQSEELWNEIVENQVK
CFRCYLNCLCDISTLNRIWIYSLNDQKSGGKTYIEFTYDNTSALAITARTFFLAVATSLK
RKQPLALSSDWSYLDFAPCNKRHLSTKDSSPHSSSGNLACYFQPFDLFALPRPLVSNDTL
RRKEQKTEEPAWFANCCINLPVTNALSVIPAHYRERGQFWWMSTMAGLLLKENPHLSNLI
KRAKLASSFRQPCIGVHMRFGDACYHEPEFMKVGGATSQRRCYETAAYMRGIARLQAAFN
IDHVYIATNNESAVRDLVRSNSTIKWSFLSSVDRSQLVKEGKKEFVMPHMLVTRLGLLDR
KVECKAFVGQFSSAFSVLAFELMVAYHAYVGSQHESCWLVV
Download sequence
Identical sequences L1JB90
XP_005832751.1.50599 jgi|Guith1|108224|au.33_g9326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]