SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|108846|au.36_g9948 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|108846|au.36_g9948
Domain Number 1 Region: 588-664
Classification Level Classification E-value
Superfamily E set domains 0.000000102
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 2 Region: 676-756
Classification Level Classification E-value
Superfamily E set domains 0.00000014
Family Other IPT/TIG domains 0.048
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|108846|au.36_g9948
Domain Number - Region: 816-892
Classification Level Classification E-value
Superfamily E set domains 0.000677
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number - Region: 523-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 1079-1166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0675
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|108846|au.36_g9948
Sequence length 1927
Sequence
MNTPAPLLFILFLLLALTPCESFSFPSSDLLQQHPVLSQQKLDCGIDIQGPSWLLQLDFR
VKFKNGSCALGHVCIEDQFRNQLLNSSSRLHQVLKNGKFAKLLSKVGEKQGLVPLPTQNS
LLYEYTHSSRRLLQTTTTTDTRSRQLIILQIAVLLGVRQVGFATLQSLGDLMSSVKYSTL
GALSDLTPKLSSISSADAIKEQQKILTFLSSVIDRLTVLQECPDQGIQDLIDVTSILLGV
AYCSVIQVRDATSAIDWAGVAMKLDCLHENIQDATYPLALANRTGMFVTKCKQAKLSPSN
LLLPLQPILVDTDIPISTVPLDGSLSPVISSWMRSTNRQITVKPAHLDANGNWLIPGIDV
TIVVMKGNLSCSSAICDEYTYVTVASYEPSLSPFAPYEPSYPSSSPFVDDLNPFIGDLLT
EVHILKMDGGPWEEWRKSGSLSVQAYFNQIRSNADTLTTEVTIPTCVQFVQNSTRWTDEG
CRCLDAACQQCNCTYASLIMPGANNGTASYQDFISIAVRRRKWCASTYGVVCSGHGVCVS
GACVCNSGFAGQNCNSTCLDCNGHGTCSPTDGRCICDPGYAGVGCSIRPVVRFVVPLFSK
PAGGITVSVIGEGFGKTDPSPEIKIGNSFCRSSTWQSPTMIRCMLSPGVGEMLSVSIFAG
GVSDSTGGMDSLLFSYSAPVITGLERQGGPTTGRYVLTMYGQNFGTHWNDKIPFDGKVKL
NVTLCSPSQWISDSTIRCAVPPGQSRNVPVLVEIPADQPRDKCDGYYIGRTTNIDDPRVI
RCGICQGCYVFNYDAPVITRLAAGINKAPETYLFRGGEILTIFGSNFGIDASVAVGPDPN
TGETYYCVFQRNFVVNTADCPNAECLFCKLGPGGGAYPITVWLAGQKSQYDLPFKFRGRA
VGLKFQETPSLTATLAGVIEKQPRLKVIDDLDDNQPLLRPDAEYNFPYWQGPAGTFQEYN
PDGYICRVDISLLPDPSKPFPNPCTPQWEAIIQQDPSKVGTFPCFEKDQPLNRNYKRGTG
LQDKVLFKASDNGMATFSDLEFLGHPGQQYNMTFSISDLGNSYVTKKSFYTSWVITFDDC
PAGQIGTWDRLCECAKGYEPGGATGCQRCDGGQAKNEGGQSDEAGSYKPTTGQASCTKCP
SQNMITSNSTTRDSVGTCFCASGYFRAAIIYDYNASYTPNVPFGFDTAASGAGDELCGGP
GSSQVLPGNGNDTTILCLDSIEFESVDCGRVRGHIVNNLWVSVKLETAGACDQQYNPKIC
TSCKSKTGCRGDSYGVGTQGCNVHHKGVMCQLCERGYYLSSSASCIKCPSQQTYALTFGL
GAFGLLVGGFIALRYLALIKLLADPPSVKIFAAYLIITSSISSSYDVQLPSSYSSYQSQT
GFAQLDISGVLYCIIQSFEYTFYHNVVLQASLPFMIIFLAQTALTVRYSMISTHFAAKRK
ADRRGLNTDKINTQENSAKTNVKEMVISGSSQVLMFIHPTVTTTMFSMFSCTPIFGYNLP
WLRIDVRYQCYDTSWWIFCYVALSVICVYTFGLPFLFFVLLQRRRHALEESKAVVRKRYQ
SWMKSLKQKAANAKLAVMRGEVPEPLKDPEEEEIVNQDIKVVYDMYYSCVREWQELLFLH
RDYTLARFYWELVEIARKQALVAFVVIIGNFAKGFDLVFGILVLFVFFAVHLYALPYKRG
KHNFLKAAEMFAEYMTLFLTLLILLAQVNPEMQPETVGKAMLGLQGLLFGGGVCVLFVNL
REGIEELKKKKEEEEGLGIVQKVERHSIYSVFFAINLLSRLIRRKEAERASRKGVTVHEE
KETIDLDGFKPQVQRRWNTLTASLLAASGDEAMLLLQYALQQKEDEGEDSEEMEASEQIS
EGSVFSSEHFTDEISEAEQRELQTLQDVEDDDDDTDISDDDSHTKFAITPGGGVFSEEGV
GIDRLDQ
Download sequence
Identical sequences L1JAT7
jgi|Guith1|108846|au.36_g9948 XP_005832185.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]