SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|109073|au.37_g10175 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|109073|au.37_g10175
Domain Number 1 Region: 314-445
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000662
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.029
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000437
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|109073|au.37_g10175
Sequence length 710
Sequence
MSPSDGQLFALHHEVQVSLLVDGVVGEGWEAVIHLDGEPTLTFELENHRTSYQITLAAVS
QGDHYVSVTFSDQHSMLSADPEKVGFRIGHSSEERGVNDAANVSDQSHTLRQRLEDVKDV
SFVIIFFPPRQHCFISRNDAAISFAISEKYFSRFPEASKASLIINDHVALQWELDANMKS
DPLSGTAMDLSDGLNYFASLTGFEDGFYQAKLVLTHGQSGEAIGRPAFTYFAVDEELEGA
EGSCEDFWERGREGAGGEKLDIGLEQTHFIYGRGGPWKWGGLYGEQKRADGRRKEEGTCE
DGSCDAASSMRRRRMTNVAYKKPVTLSSTGAGASENAVDGIVNVFYSVPFEQSHATTSGK
VGEVEWLEVDLGRNEFVRAIDVWGAARARARLQYPMVVDEGSLAPFQVHFITENGETSNV
LHFDDHSSVFSRTGILGVARHVRISRQLQDGSAALAVLELQVRVELTSQLYSHPPREQVW
AEQEWECSRQCLHGRCVLDQRREDLICECDADWAGEMCNVHMLMTWRHLPFGVGGVREDS
FWDQRLFDEAVNDLRAVQFPERCEAADSVNIRFENRGAAATFNYIGGLLSLSYLQGKTLI
LPTDDAWVYAHNQGCTDFECYFEPWTSCPENTTNKTGSFQMARSTHEMVFAMVPNKFARK
GLLVRPDILQGQDFTVCALLLESDKVLSLSTELDVNSTMSRMRWSRPVLG
Download sequence
Identical sequences L1J8Z4
jgi|Guith1|109073|au.37_g10175 XP_005832008.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]