SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|109523|au.40_g10625 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|109523|au.40_g10625
Domain Number - Region: 176-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000709
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 268-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 84-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000902
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 360-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|109523|au.40_g10625
Sequence length 466
Sequence
ESFTGPRCERCAADLYGPNCSVYCTANGTCSGQGVCRESDGGCECELGWGGRWCNVSNTS
ATVAAPSGCLSARDCNATAGRALCVNGSCVCKESFTGPRCERCAADLYGPNCSVYCTANG
TCSGQGVCRESDGGCECELGWGGRWCNVSNTSATVAAPSGCLSARDCNATAGRALCVNGS
CVCKESFTGPRCERCAADLYGPNCSVYCTANGTCSGQGVCRESDGGCECELGWGGRWCNV
SNTSATVAAPSGCLSARDCNATAGRALCVNGSCVCKESFTGPRCERCAADLYGPNCSVYC
TANGTCSGQGVCRESDGGCECELGWGGRWCNVSNTSATVAAPSGCLSARDCNATAGRALC
VNGSCVCKESFTGPRCERCAADLYGPNCSVYCTANGTCSRQGVCRESDGGCECELGWGGR
WCNASNASSLTGCFSLSKCSSVSGYAFFTWLWFGAFGRLLTMFCVF
Download sequence
Identical sequences L1J7V5
jgi|Guith1|109523|au.40_g10625 XP_005831382.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]