SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|109956|au.42_g11058 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|109956|au.42_g11058
Domain Number 1 Region: 8-98,211-451
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.31e-26
Family Pectin methylesterase 0.065
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|109956|au.42_g11058
Domain Number - Region: 585-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 502-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|109956|au.42_g11058
Sequence length 1127
Sequence
MRAAQARLLIAVVLQSATALAINLYVSITGDDVKGDGTLHLPYKTIQGAIDASWDLDVIV
LLDGHHVSDKEIRFRGRKLTVRGDSPPVTRYGSCWPVMTADPLVPTLSRCNISSFPQTWS
QRQYNDFMEVGQETTVQWFPPSHADPAMADPAYHAVLSYDLGVRDPSNPPRSCSGSISAG
SRWSCGLMGCKYNFSGSGDEQAAINSAVRIVGARFIFLEGDEVILRDLDIRGQDENFATA
SAIEGGCLFSTGRNNITVVDSVLSSCSSKLSGGAASIGFESKMTFRGVRFLNNSARNGGA
MSFKMRSTVLCSHCEFSGNLAEKGGGIYVDDVSSPQFESCDFYSNTGTYGGAIYAGGRSS
PAVVDSAFVHNSALDGAVIYAGNMAIIDTANCTFQNNSAERYGGVAVLEQGGSLWSRGDA
MFFNFASRAGAAIYSKNADPNRWRDSYQVQNRFNLLSLHDDNFLLNTAAIFAGQVYPKAL
SDAVFSSSNGNKICNGRGSLDENLECLCRLPYTGVNCEVQCKGLLLLDSWNGTSNASSGN
HTANATSTVVCSGHGTCLVGSAVFDTECRWFGGRSDCSQKCPGTTQSSVCSGHGDCFLEN
GTATCSCFFGWGGEECDEIRLYVLGTGGNQSRLNRVIRLGDKMLANNRESGLHLLVLNRT
DLTVVWDYSYEVMKFEYPASQYSSERFYLFGGNDGTINVATGIAEDGTCGSLNSSTDGVL
TRNPQVSSYYFGEGEANRMARDLSLFDARHLAIVSSFFAWENHTNPALLQALKRIGGPDL
EPFVQDKQGSGHALIIVGIPDSGEGNGTFMLSPPPDPAAGYATSVAEVEVNLKSRVEEEA
VLWCGARVYEHGVDVSHLVGTACVRDGQVVANFEDGADGIIGGGLAVEPVKTIRTETVRN
ETGGQVARWFVVARAPPDTPRLEAWDLLSDFDLSSGPSPLLLSSSTIVQPCCNRSVRWNH
GGCRKGRTVSRSPQTLEGEILVCEQSGWLLEDGSTWPGHFGNLDLAGPFGDSLNRNEDDL
IASQPDPLRGAYTPYDYQPGHRNTPFTEEDIVPQLQEQLPPRGLQDLYSSFLEVPTPTPV
FKECEVGVNECEQRSVLDPAVLNECSLGQCNVDTGWEASQRWQKPLS
Download sequence
Identical sequences L1J751
jgi|Guith1|109956|au.42_g11058 XP_005831152.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]