SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|110724|au.47_g11826 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|110724|au.47_g11826
Domain Number 1 Region: 1456-1572
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000181
Family C-type lectin domain 0.0065
Further Details:      
 
Domain Number 2 Region: 286-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 171-225
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 4 Region: 349-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000372
Family EGF-type module 0.04
Further Details:      
 
Domain Number 5 Region: 717-886
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000197
Family Trypanosoma sialidase, C-terminal domain 0.067
Further Details:      
 
Domain Number 6 Region: 1205-1277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 7 Region: 225-283
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000785
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|110724|au.47_g11826
Domain Number - Region: 1008-1147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000183
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 405-454
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00918
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number - Region: 948-1052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0471
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|110724|au.47_g11826
Sequence length 1575
Sequence
MRALEWEIRSIKQSLSATLDELRSLNSSVTSMPQLPWGNFTSNSVRCTLAYNWSQIIEKE
DQGRVQLGGLGHLMQIDRFEVWVCDYDNRCVQQTGDAMCFVFDEVQEVFLPWGLDSQLLL
TQQGPFQPDLAVSHILAKLKALEQEIRSGGCGGSCVSRQDVQQLLDQYYLEPGYLWSAGS
FSECSSLCGSGVARRSITCISKLLEQVEDIRCSNRSKPLAEVPCLNLSQCSYEWEVGPYS
ECLNGCGQGLRRRSVSCRRSDGVTVEIGKCQGWAPVNEEPCSNFSSCSYRWTPSAWEACS
STCGPGLQYRSVMCVRSDGVEVGEGMCEGSKPRTFQACTGASGCNYTLINECAAHTDNCA
THASCIDTYSSFECSCKPGFVGSGTVCEDVDECEALSACASEVRQAKQDFYLDVDSSSCL
SCPTGQYASSLGQTSCTTCAPGFYGSSNSSCSSCPPGSSSPAGSTLVSDCQCQYGFSGSI
STAADSCSPSSSAEEQSRWFRLGAVGQSCAETCAAEGKTCVSSAINQIDNEEAMRSAVRA
ASIASDRRIRGAMTEPQQRPGGLHLRVSAGANERGGDVLQDLTANRGHVQRLRFVEHGVT
KFDLLSNRVQTFFDVKQTFHVGLPDALQYSGTIVISVTVEDAESFDSIQSAYIEVAGRRC
AFTDPATGNAKNLQQIHCKLEVTRQEAMADGARIGPILISYDAIGNNGRSTWRIAVGEMK
DETGEPLRVMSDGELKYVNGSINDVVLFPPLSIPGAAFTLCSISRYNGNRKNRVLQASDD
SFLHGHWNGGRGQSYYYDTWILQQDLSTTADEWVVLCGQNYQYGKFFLNGVEYERSMPTL
PDSLQLSINDLSWHPSVGYFLDTSDWALSEVAIWRGVLRADEIRAVSDHLLRMLSDGSSV
RYNQTLNVSCSIVGSAVNKIAPYVSSDGGCYFSSPIYQSTCDASLSTASRVCLCAAPCLE
DFYGQAEECFRCPFFSHSQPGSSSIRDCSCQQGRYLYVNSSDAPWGPQGSCESCPPHAWS
PTGSSSVNQCQCIGGYYLDEGPSCSSCPSGLKSPYGSSSLNECMCPAGAYKSEGNCSSCP
AYSTSKAGSTSVEDCFCMPGFGVKATGFSRQITSPSDRCEPNLRELILADMKGASCSQVC
QSENLACVEEGQPVLREEEISLLLSTWGFPVSGIVGTNSLDAPSYNPETQQAFFRYGLPG
MCGATDSSNLRICRCTCDDNQYGKTGNCSSCPANSHSSFQAQEASSCMCDSGYFFDASAG
TCSLCPSGNYTEEQRFVDRDFGLNGGSGWRGTEKTSSCGSYGSVLGGFNVLGEQSSLTKT
FTGLCPHGFLHIWMRVLLIDFVQPVTLRLTVDRREVWSESIPASSSSLSECGQAAGEEMI
ERLIRVYHTEDHVEVNIQVDYDYWEVSAATAKTFWGLKELSVVLPCSSSADCSMTSSAYQ
TCSDVQGSAAACLRVGEYLYVYHYGYFLSSQIEPTCKQIGRGGQLAYFPDRKTYDELRSR
LSLGLYTRIGLSVERGSSYFRWTAGGAFSSQTWGDVGPQLSGDDACVVLYDNSWLPLQCS
DSATYLLCSYPIAAQ
Download sequence
Identical sequences L1J464
jgi|Guith1|110724|au.47_g11826 XP_005830288.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]