SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|112067|au.56_g13169 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|112067|au.56_g13169
Domain Number 1 Region: 94-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000594
Family EGF-type module 0.025
Further Details:      
 
Domain Number 2 Region: 130-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 424-470
Classification Level Classification E-value
Superfamily LysM domain 0.0000432
Family LysM domain 0.0074
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|112067|au.56_g13169
Domain Number - Region: 24-80
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 473-506
Classification Level Classification E-value
Superfamily LysM domain 0.0131
Family LysM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|112067|au.56_g13169
Sequence length 518
Sequence
MSPHGFWLVFLSLFISVTGTFAIVCNPGYEVKVLLNGTSCVACGVNMYSTGTTCLACPSH
SSTKGLGQQGACICDGGYQALLDTSTNIPVSPLTCTDINECLSPSACDVHATCSNTIGSY
TCTCSAGYSGDGLLCQNVNECTQGVCDPKANCTDTQGSFICVCPTGYYDLSLKDPNIGQG
RICKEYGLYFEPIDNLVGKVGQPVVVPFVIGNYDPNYVFSSSLSVVVIAPDSVTVSKEVA
QSNGFLRLTPAVIGTFRINITVSDINTKPGLVSFTLTSTVLTPFFDNVPPANTFQDLKTT
SGTPTFPHTFRVGHEDANRLGALTIRATSGNLTVVPDNCCENTSTFREIGGIFLNFTTER
VQMIYNGNTVYARNVMVVINPRGIATSTTGVDLRFFLTDTQQNIVIAASIKLYVYPRPSI
TTFCTYDVQETDTLISISNLFGMHWMTLFMLNNNSITHPDRVLPGSRISIGRPYIVKGDD
SIYSIATRFDTVPDERAIFAGQLLCIAPDLAFLSCMEQ
Download sequence
Identical sequences L1J0B1
jgi|Guith1|112067|au.56_g13169 XP_005828911.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]