SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|114873|au.79_g15975 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|114873|au.79_g15975
Domain Number 1 Region: 314-496
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000166
Family YicI N-terminal domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 215-269
Classification Level Classification E-value
Superfamily Trefoil 0.00000000602
Family Trefoil 0.0024
Further Details:      
 
Domain Number 3 Region: 502-793
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000168
Family YicI catalytic domain-like 0.04
Further Details:      
 
Domain Number 4 Region: 177-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family EGF-type module 0.057
Further Details:      
 
Domain Number 5 Region: 83-218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000116
Family Growth factor receptor domain 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|114873|au.79_g15975
Domain Number - Region: 795-856
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00647
Family Putative glucosidase YicI, domain 3 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|114873|au.79_g15975
Sequence length 1117
Sequence
MKQTRVLAIALTFLVFCLHTLHSLPYPYESNDGLRIHTVEGRFIAVENEQALNNSLRAPQ
ASSTSEADLSEFLKFVLSELNPCIEGKHACDPHASCIPLVKDAAQRALEYICTCKAGWSG
NGFYCENINECQVHGSDVNPLCESGMYCKDTMGSFECLNNHGFDGMDKGTIPVDVDECMQ
GSHNCHEHAQCHNVPGSFTCTCSLGYNGNGTTCWNMCHEAAPAQRINCFQDDTPSEETCV
HRGCCWNPSADMPNTPCYYPLPANFYRLVSWTETSSGVLAVLDCDGEMRYGDGRGGGGTR
PFHIGPFGSEICPLHLYVSFESEDHLQIRIFDASKPQSMIPPYFFPDRRTKEHKAEDRKY
SVKYIGYPFGLIVQREPDGLVLFNSTPVPGRMNGLSFEPQFISLSTQLEEGTIFDGLGPA
SSTPYESKESLKTYLVWPSTSNQSTSSPFLLSLSKEQEAKFGLLMSNPHAMEVLFARDSL
TFRMIGGEIDLRIFVGGGSKTIVKRLTDVVGKLEDLPPLWSLGMLVKLNSTTSSDNVGQE
AENLMEMLDNQDIPYDGIVVDVRDFSDYSENELYSKNLGRSDKNFARKVSDMSVHVRGRG
KKLITAVYPSSLTLEDAIIRDKFNKPVRGKMKGEDVFYLDFFNPNITRTWGDRLERLSKI
IEFDGIMLESFQPENECNGICLETCDRLNKFDSTEKATCSRSFQTERRRDHYSLHNLYEM
SAAFVSYQVLSDLLPSRPLILSRSDAPGIGQWATVMDDMKSQDFSSTLSRLVSSAISLTS
YIYTCVYFSHTTGVPVIRPLHMEFSMAGDESKKEEVANNIMFVLGSSILVVANLNMEGSS
ISVQLPSQRWYNLNSGLEEKRSGAGAGAGAGAEGAGKIVLSAKLGILPVAIMLLKGGSVL
SLQFPATNMNDKSESPFVFVCAPDEAGKGAGDLYLDDGKSQKNVLNGRFNLLRSNCFVDG
KNQLGNFTLQSLKRDSASQPGPMRSEIRKIVIFGASFHHPAQLVVRVNGHTMSNKRIYYE
ETRSILHIDLFRASSQAGERETEERKEDLYVKKPEERGREGKEEERGRQGDRRVDTIAPW
DWMEPREEKGKAGMQGEEGEGKLDVLNDLHVDWRIEM
Download sequence
Identical sequences L1IRX3
XP_005825973.1.50599 jgi|Guith1|114873|au.79_g15975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]