SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|114973|au.80_g16075 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|114973|au.80_g16075
Domain Number 1 Region: 127-474
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.97e-43
Family AAT-like 0.0000337
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|114973|au.80_g16075
Domain Number - Region: 88-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|114973|au.80_g16075
Sequence length 478
Sequence
MEREDEETGMIEKEEGGKKVWKDVVIGVLLLCTLSLGISTALLAAKAANKASSIGEFFCQ
ISGTIPSTPAPAPSPPVISTELSKVVDETMSACSNQGYKYTGETNCTCMDCYTGARCQTF
VGADKCSIDANGGSPYMFAEYWVRYPETEFQMKLSERLGYLPAGIRSRLEEGIRKLHKLA
GNAVTDNMNIVFGDGSTPLLTLVSTILQSSTNSLPLKVWAQKPFYSGYSSLSYANLVKFV
GDEENRTTAAADEKVVEYVTSPNNPDGEIRTGVLSHPLTVFDKAYSWPMYTFIDQPFNTS
AHPLSLWTLSKVTGHASSRVGWALVGDKKLADAMQAMACPIGCPVESQLVAIRAIEHVLS
TQGELMKWGRAKFTERWGRIGEVFRNVSCYKVRNPRAEGYDRYDQKVYKQTPPYLWMECL
NLPDQKSCGDMLRSYGMKCRDGEYFGMPKSFARLSLYVASPVFNVLIQKLTNMFANTC
Download sequence
Identical sequences L1IS14
jgi|Guith1|114973|au.80_g16075 XP_005825847.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]